LGALS12 (galectin 12)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 85329
• Gene name: Galectin 12
• Gene symbol: LGALS12
• Synonyms (NCBI Gene): GAL12, GRIP1
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: This gene encodes a member of the galectin superfamily, a group of beta-galactoside-binding proteins with conserved carbohydrate recognition domains. The related mouse protein is a primary regulator of the early stages of adipose tissue development. Alter

miRNA Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1108198	hsa-miR-151-5p	CLIP-seq
MIRT1108199	hsa-miR-151b	CLIP-seq
MIRT1108200	hsa-miR-3121-5p	CLIP-seq
MIRT1108201	hsa-miR-3131	CLIP-seq
MIRT1108202	hsa-miR-3914	CLIP-seq
MIRT1108203	hsa-miR-3928	CLIP-seq
MIRT1108204	hsa-miR-4325	CLIP-seq
MIRT1108205	hsa-miR-507	CLIP-seq
MIRT1108206	hsa-miR-557	CLIP-seq
MIRT1108207	hsa-miR-611	CLIP-seq
MIRT1108208	hsa-miR-1972	CLIP-seq
MIRT1108209	hsa-miR-3136-3p	CLIP-seq
MIRT1108210	hsa-miR-4297	CLIP-seq
MIRT1108211	hsa-miR-4650-5p	CLIP-seq
MIRT1108212	hsa-miR-550a	CLIP-seq
MIRT1108213	hsa-miR-581	CLIP-seq
MIRT1108214	hsa-miR-642a	CLIP-seq
MIRT2260783	hsa-miR-1291	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030395	Function	Lactose binding	IBA
GO:0030395	Function	Lactose binding	IDA	11435439
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	11435439

Other IDs

• MIM: 606096
• HGNC: 15788
• e!Ensembl: ENSG00000133317

Protein

• UniProt ID: Q96DT0
• Protein name: Galectin-12 (Gal-12) (Galectin-related inhibitor of proliferation)
• Protein function: Binds lactose. May participate in the apoptosis of adipocytes.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00337	Gal-bind_lectin	48 → 182	Galactoside-binding lectin	Domain
  PF00337	Gal-bind_lectin	211 → 336	Galactoside-binding lectin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Not widely expressed. Predominantly expressed in adipose tissue.
• Sequence:

  MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAG
  KMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQRE
  ARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAV
  GFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFT
  VSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL
  ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS

• Sequence length: 336

Related Genes

No strongly related genes found yet for LGALS12.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LGALS12.