LEP (leptin)

Gene

• Entrez ID: 3952
• Gene name: Leptin
• Gene symbol: LEP
• Synonyms (NCBI Gene): LEPD, OB, OBS
• Chromosome: 7
• Chromosome location: 7q32.1
• Summary: This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathwa

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894023	C>T	Pathogenic	Missense variant, coding sequence variant
rs201523305	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs724159998	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs1554394014	T>C	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1107446	hsa-miR-1207-3p	CLIP-seq
MIRT1107447	hsa-miR-149	CLIP-seq
MIRT1107448	hsa-miR-155	CLIP-seq
MIRT1107449	hsa-miR-1913	CLIP-seq
MIRT1107450	hsa-miR-1914	CLIP-seq
MIRT1107451	hsa-miR-197	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT1107453	hsa-miR-24	CLIP-seq
MIRT1107454	hsa-miR-298	CLIP-seq
MIRT1107455	hsa-miR-3125	CLIP-seq
MIRT1107456	hsa-miR-3183	CLIP-seq
MIRT1107457	hsa-miR-3187-3p	CLIP-seq
MIRT1107458	hsa-miR-3194-3p	CLIP-seq
MIRT1107459	hsa-miR-324-3p	CLIP-seq
MIRT1107460	hsa-miR-326	CLIP-seq
MIRT1107461	hsa-miR-330-5p	CLIP-seq
MIRT1107462	hsa-miR-3662	CLIP-seq
MIRT1107463	hsa-miR-3678-3p	CLIP-seq
MIRT1107464	hsa-miR-3916	CLIP-seq
MIRT1107465	hsa-miR-3921	CLIP-seq
MIRT1107466	hsa-miR-411	CLIP-seq
MIRT1107467	hsa-miR-4270	CLIP-seq
MIRT1107468	hsa-miR-4284	CLIP-seq
MIRT1107469	hsa-miR-4290	CLIP-seq
MIRT1107470	hsa-miR-4435	CLIP-seq
MIRT1107471	hsa-miR-4441	CLIP-seq
MIRT1107472	hsa-miR-4536	CLIP-seq
MIRT1107473	hsa-miR-4633-5p	CLIP-seq
MIRT1107474	hsa-miR-4653-5p	CLIP-seq
MIRT1107475	hsa-miR-4661-3p	CLIP-seq
MIRT1107476	hsa-miR-4687-3p	CLIP-seq
MIRT1107477	hsa-miR-4695-3p	CLIP-seq
MIRT1107478	hsa-miR-4701-5p	CLIP-seq
MIRT1107479	hsa-miR-4716-5p	CLIP-seq
MIRT1107480	hsa-miR-4723-3p	CLIP-seq
MIRT1107481	hsa-miR-4766-5p	CLIP-seq
MIRT1107482	hsa-miR-4781-3p	CLIP-seq
MIRT1107483	hsa-miR-483-5p	CLIP-seq
MIRT1107484	hsa-miR-498	CLIP-seq
MIRT1107485	hsa-miR-5096	CLIP-seq
MIRT1107486	hsa-miR-532-5p	CLIP-seq
MIRT1107487	hsa-miR-548s	CLIP-seq
MIRT1107488	hsa-miR-588	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT1107490	hsa-miR-647	CLIP-seq
MIRT1107491	hsa-miR-659	CLIP-seq
MIRT1107492	hsa-miR-7	CLIP-seq
MIRT1107493	hsa-miR-877	CLIP-seq
MIRT1107494	hsa-miR-9	CLIP-seq
MIRT1107446	hsa-miR-1207-3p	CLIP-seq
MIRT2029684	hsa-miR-1972	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT2029686	hsa-miR-4264	CLIP-seq
MIRT1107472	hsa-miR-4536	CLIP-seq
MIRT2029687	hsa-miR-4634	CLIP-seq
MIRT2029688	hsa-miR-4650-5p	CLIP-seq
MIRT1107476	hsa-miR-4687-3p	CLIP-seq
MIRT2029689	hsa-miR-4743	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT1107490	hsa-miR-647	CLIP-seq
MIRT1107451	hsa-miR-197	CLIP-seq
MIRT2029684	hsa-miR-1972	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT2260566	hsa-miR-2278	CLIP-seq
MIRT2260567	hsa-miR-23a	CLIP-seq
MIRT2260568	hsa-miR-23b	CLIP-seq
MIRT2260569	hsa-miR-23c	CLIP-seq
MIRT2260570	hsa-miR-3180-5p	CLIP-seq
MIRT2260571	hsa-miR-3189-3p	CLIP-seq
MIRT2260572	hsa-miR-331-3p	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT1107466	hsa-miR-411	CLIP-seq
MIRT2029688	hsa-miR-4650-5p	CLIP-seq
MIRT1107479	hsa-miR-4716-5p	CLIP-seq
MIRT2029689	hsa-miR-4743	CLIP-seq
MIRT1107481	hsa-miR-4766-5p	CLIP-seq
MIRT1107482	hsa-miR-4781-3p	CLIP-seq
MIRT1107483	hsa-miR-483-5p	CLIP-seq
MIRT1107485	hsa-miR-5096	CLIP-seq
MIRT2260573	hsa-miR-520a-5p	CLIP-seq
MIRT2260574	hsa-miR-525-5p	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT2452924	hsa-miR-1254	CLIP-seq
MIRT2452925	hsa-miR-1276	CLIP-seq
MIRT2452926	hsa-miR-138	CLIP-seq
MIRT2452927	hsa-miR-3116	CLIP-seq
MIRT2452928	hsa-miR-320e	CLIP-seq
MIRT2452929	hsa-miR-3907	CLIP-seq
MIRT2452930	hsa-miR-4254	CLIP-seq
MIRT2452931	hsa-miR-4434	CLIP-seq
MIRT2452932	hsa-miR-4516	CLIP-seq
MIRT2452933	hsa-miR-4531	CLIP-seq
MIRT2452934	hsa-miR-548q	CLIP-seq
MIRT2560591	hsa-miR-1281	CLIP-seq
MIRT2560592	hsa-miR-1915	CLIP-seq
MIRT2560593	hsa-miR-4279	CLIP-seq
MIRT2560594	hsa-miR-4503	CLIP-seq
MIRT2560595	hsa-miR-4726-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Activation	21983012
HIF1A	Activation	18559540
HIF1A	Unknown	19080496
KHDRBS1	Activation	21672929
SP1	Activation	18559540
STAT3	Activation	18242580;19492417

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001525	Process	Angiogenesis	IDA	19910644, 21771332
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001890	Process	Placenta development	IDA	17957153
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	11460888
GO:0002021	Process	Response to dietary excess	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IDA	27037668
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005515	Function	Protein binding	IPI	22405007, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005615	Component	Extracellular space	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006112	Process	Energy reserve metabolic process	IBA
GO:0006112	Process	Energy reserve metabolic process	IEA
GO:0006112	Process	Energy reserve metabolic process	TAS	9537324
GO:0006114	Process	Glycerol biosynthetic process	IEA
GO:0006629	Process	Lipid metabolic process	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008206	Process	Bile acid metabolic process	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0008343	Process	Adult feeding behavior	ISS
GO:0009062	Process	Fatty acid catabolic process	IEA
GO:0009892	Process	Negative regulation of metabolic process	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	25060689
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010888	Process	Negative regulation of lipid storage	IEA
GO:0014823	Process	Response to activity	IEA
GO:0019222	Process	Regulation of metabolic process	IEA
GO:0019953	Process	Sexual reproduction	IEA
GO:0019953	Process	Sexual reproduction	IMP	8589726
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0030217	Process	T cell differentiation	ISS
GO:0030300	Process	Regulation of intestinal cholesterol absorption	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IDA	25060689
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0032099	Process	Negative regulation of appetite	ISS
GO:0032310	Process	Prostaglandin secretion	IDA	19688109
GO:0032355	Process	Response to estradiol	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19688109
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19688109
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032814	Process	Regulation of natural killer cell activation	IDA	12504075
GO:0032817	Process	Regulation of natural killer cell proliferation	IDA	12504075
GO:0032868	Process	Response to insulin	IBA
GO:0032868	Process	Response to insulin	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	IDA	27037668
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0033686	Process	Positive regulation of luteinizing hormone secretion	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035630	Process	Bone mineralization involved in bone maturation	IEA
GO:0035904	Process	Aorta development	IEA
GO:0038108	Process	Negative regulation of appetite by leptin-mediated signaling pathway	IBA
GO:0038108	Process	Negative regulation of appetite by leptin-mediated signaling pathway	IEA
GO:0038108	Process	Negative regulation of appetite by leptin-mediated signaling pathway	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	25060689
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IDA	12504075
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043270	Process	Positive regulation of monoatomic ion transport	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24340098
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044320	Process	Cellular response to leptin stimulus	IDA	17344214
GO:0045471	Process	Response to ethanol	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045765	Process	Regulation of angiogenesis	IDA	11460888
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0046325	Process	Negative regulation of D-glucose import	IDA	24340098
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	17344214
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046850	Process	Regulation of bone remodeling	IEA
GO:0046850	Process	Regulation of bone remodeling	ISS
GO:0046881	Process	Positive regulation of follicle-stimulating hormone secretion	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0048639	Process	Positive regulation of developmental growth	IDA	17957153
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050810	Process	Regulation of steroid biosynthetic process	IEA
GO:0050892	Process	Intestinal absorption	IDA	24340098
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IDA	15899045
GO:0051051	Process	Negative regulation of transport	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051541	Process	Elastin metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	17344214
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060587	Process	Regulation of lipoprotein lipid oxidation	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0070093	Process	Negative regulation of glucagon secretion	IEA
GO:0071298	Process	Cellular response to L-ascorbic acid	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0090335	Process	Regulation of brown fat cell differentiation	IEA
GO:0090335	Process	Regulation of brown fat cell differentiation	ISS
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	27037668
GO:0098868	Process	Bone growth	IEA
GO:0098868	Process	Bone growth	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27986616
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	19688109
GO:1900180	Process	Regulation of protein localization to nucleus	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	24340098
GO:1904651	Process	Positive regulation of fat cell apoptotic process	IEA
GO:1990051	Process	Activation of protein kinase C activity	IDA	24340098
GO:1990460	Function	Leptin receptor binding	IBA
GO:1990460	Function	Leptin receptor binding	IPI	27037668
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA
GO:2000486	Process	Negative regulation of glutamine transport	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IEA

Other IDs

• MIM: 164160
• HGNC: 6553
• e!Ensembl: ENSG00000174697

Protein

• UniProt ID: P41159
• Protein name: Leptin (Obese protein) (Obesity factor)
• Protein function: Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pat
• PDB: 1AX8, 7Z3Q, 8AVE, 8AVF, 8AVO, 8K6Z, 8X80, 8X81, 8X85
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02024	Leptin	23 → 167	Leptin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Adipose tissue is the main source of leptin. It is also produced by other peripheral tissues such as the skeletal muscle (PubMed:12448771, PubMed:16052473, PubMed:7789654). Expressed by intercalated and striated tracts of submandibular
• Sequence:

  MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
  DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
  WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

• Sequence length: 167

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
LEP-related disorder	Likely pathogenic	rs28954113	RCV004753693	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leptin dysfunction	Pathogenic	rs724159998, rs200575914, rs2485445933	RCV000149807 RCV003313818 RCV003313819	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obesity due to congenital leptin deficiency	Pathogenic; Likely pathogenic	rs200575914, rs2485445933, rs771139087, rs104894023, rs1554394014	RCV003318515 RCV003318516 RCV000015023 RCV000015024 RCV000518717	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic diabetes	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Monogenic Non-Syndromic Obesity	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY, MORBID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	29364741		★☆☆☆☆ Found in Text Mining only
Ablepharon macrostomia syndrome	Ablepharon macrostomia syndrome	Pubtator	26637991	Associate	★☆☆☆☆ Found in Text Mining only
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	16449022, 28081576		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	26860691, 29872305		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	26860691, 29872305		★☆☆☆☆ Found in Text Mining only
Acquired partial lipodystrophy	Acquired Partial Lipodystrophy	BEFREE	28371314		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	28791847	Associate	★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	31361303		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	20174754		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	17072067, 21955253		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	23741006, 30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	12138320, 28849043, 29934609, 31054479		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11053255, 24569475, 29158066, 30142858		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16434209		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16740977, 18313838, 24569475, 28285359		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	30142858		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	31425509		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11422113, 12354126, 18086776, 25313911, 27611607, 29464548		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	18086776, 21720710		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19221001		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22193626, 30279628		★☆☆☆☆ Found in Text Mining only
Adiponectin Deficiency	Adiponectin Deficiency	BEFREE	28758929		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	10333078		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31738032		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	10333078		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19497390, 19725899, 20422702, 29314270, 29806975, 29885866, 30218387, 30473626, 30951821		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	BEFREE	28423238		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21983012, 23895348, 29070909	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24359504, 30775986	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29974394		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24874077, 25998413, 28160136, 29311632		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28663573, 29482216		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30911572	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	32963497	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21228692, 26731704, 27447624, 30079352, 30433860, 31493992, 31748652		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	BEFREE	28423238		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21926355		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	21926355, 37237325	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	25755292		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	17482294		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	27515676	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30949073		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	LHGDN	17476615		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19059800, 28534699, 28619118, 28816988, 28985620		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28027898, 30638935		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	10194520, 10223285, 19819945, 21593415, 23341784, 23359004, 28229972, 28259721, 28611344, 29379539, 30063917, 30618146, 30755658, 30945111, 31347937, 31794851, 9243102, 9621947		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	11511551, 14732844	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	LHGDN	15012781		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	11134666, 20176366, 24831852, 25998413, 27811940, 28604943, 28692876, 29099750, 30804742, 31031654, 31125904, 31156489, 31656971, 31805456, 9857981		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	12658369, 15240636, 17184143, 17558893, 18283238		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	40015467	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23153628, 28551488, 29631553, 30036185, 31189176, 31404477, 31472067, 31547319		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	35886710	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23153628, 28551488, 29631553, 30036185, 31189176, 31404477, 31420734, 31472067, 31547319		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	23220275		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	17967974		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23220275, 29877321, 30054042, 31821481		★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	40008515	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29168539		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	35524481	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	27777020		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	31316601		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15937081, 16432543, 17555952, 17587397, 20051227, 21074769, 21262584, 21385539, 21474811, 23122912, 23220275, 25573199, 26365974, 27337945, 28121618, 28122051, 29304064, 29393091, 29877610, 30347447, 31566104, 31756645, 31780867		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18196243		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19688109, 25198901	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	25383655, 30926645, 31167128		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23144698	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22866899, 36530571, 36759597	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30926645		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31147798		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	30633613		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15478389, 19191138		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19191138, 20363117, 27337146, 27473714, 28131832, 28411906, 28952460, 29665658, 29777230, 29891850, 29996681, 30203371, 30618522, 30848574, 30951821, 31004416, 31029506, 31608695		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19539983	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22773729, 22837379	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27336865, 30203371, 31029506, 31369430, 31580718	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19775291	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28249041		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30803210	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10731922, 19625677, 20145358, 21074769, 23122912, 23316287, 25573199, 30915774, 31566104, 32798443	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14629465	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15937081, 16432543, 17555952, 17587397, 20051227, 21074769, 21262584, 21385539, 21474811, 23122912, 23220275, 25573199, 26365974, 27337945, 28121618, 28122051, 29304064, 29393091, 29877610, 30347447, 30915774, 31566104, 31756645, 31780867		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29940585	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31553329		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30248249, 30687188		★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	BEFREE	30004275		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	17347881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	29791472, 30004275, 30248249, 31835709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16380228, 17349207, 21145759, 21664965, 21851341, 23447682, 23688008, 26790188, 27889607, 27916613, 29548819, 29772535, 30169503, 31110493, 31252407, 31362672, 31707542, 31822667, 31823915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23144698	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	28748541		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	29855380		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24767250		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	21209035, 22669322		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	23756394		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	29098950		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16786343, 17207170, 29356069		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	17641728		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30186533, 31805276		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	21042009		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	21042009		★☆☆☆☆ Found in Text Mining only
BETHLEM MYOPATHY 1	Bethlem Myopathy	BEFREE	28848425		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	15052530		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20814328, 27780338, 28457001, 28875764, 30047831		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	36077028, 36878995	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29602840		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	11595779	Associate	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	17425664	Inhibit	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	21920718	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	29909551		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	12033286		★☆☆☆☆ Found in Text Mining only
Brain Diseases Metabolic Inborn	Brain disease	Pubtator	18076675	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19775291, 21771332	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21771332		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10364481, 10719061, 11369444, 11911959, 12734209, 15138597, 15475434, 16011872, 16206269, 16504019, 16525650, 16533767, 16609020, 16752079, 17409452, 17653093, 18004080, 18262553, 18559540, 18668212, 18715880, 18821585, 18945363, 19017403, 19047149, 19408304, 19661131, 19697123, 19723917, 20032412, 20171193, 20193256, 20410173, 20658737, 21163886, 21516303, 21574190, 21698367, 21731759, 21840575, 21887553, 21947707, 22200873, 22490496, 22664497, 22800822, 22983835, 23162077, 23199901, 23228483, 23254958, 23358729, 23412922, 23869900, 24114531, 24176089, 24377502, 24716804, 24738610, 24825736, 24932998, 25482303, 25510398, 25721149, 25846733, 26121010, 26260992, 26286584, 26359358, 26407154, 26556856, 26696367, 26825898, 26899873, 27082857, 27177292, 27914811, 27926517, 27999190, 28188108, 28190851, 28565832, 28571770, 28714000, 28770546, 28938640, 28983080, 29048637, 29056512, 29088874, 29121911, 29254161, 29311755, 29336592, 29433827, 29869823, 29979411, 30116331, 30293548, 30397604, 30404206, 30417207, 30563531, 30634494, 30702563, 30856610, 30899280, 31015393, 31292496, 31380268, 31491560, 31538300, 31671408, 31756890, 31844100		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21353530		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12379472, 12712467, 16504019, 17344214, 18408141, 18559540, 18945363, 19017403, 19047149, 19662684, 19697123, 20569445, 21163886, 21239736, 21516303, 21673435, 22282662, 23228483, 23261058, 24377502, 24716804, 25482303, 25721149, 25846733, 26472474, 26556856, 26865587, 27415018, 27857161, 27926517, 28190851, 28542577, 28729467, 29121911, 29311755, 29370782, 30293548, 30992345, 31015393, 31292488, 31844100, 32260113, 32471192, 32736587, 32836215, 33019728, 33067778, 33380715, 33864589, 34970222, 34997107, 35092386, 35846306, 36253742, 36361728, 36941557, 37542585, 40565190	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	14985328, 16533767, 20032412, 22270359	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27177292, 31292496	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis, Chronic	Gastric Cancer	BEFREE	23966608		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	12033286		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	16570705	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	28259721, 28276114, 30900406, 9561439		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	11134666, 24831852, 28049078, 28259721, 30395874, 30915029, 9561439		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	40015467	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34093426	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15300888, 17072067, 18958356, 25027400, 26147886, 26593227, 27345723, 27480179, 27842582, 29370782, 30379922, 33587254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32471192	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17006991, 19299541, 21555376		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15300888, 16565221, 18473418, 20723213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26982332	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33369452	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14972512, 29602840		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16630717, 23430445, 24512731, 25027400, 28160559, 31119158		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	15890779, 19765303, 23551967	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39298063	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18787400, 33804101	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15522945, 19765303, 22343039, 23262295, 23551967, 28002999, 28104444, 29976638, 30450532, 31077012		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	29225622		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30004258		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	22764185	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26614846		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11795261, 15937081, 16261186, 16285998, 16320084, 17878255, 20174754, 21244662, 21385539, 21474811, 22185674, 23624317, 23688012, 24051404, 25296580, 26745681, 27310420, 27677429, 27796618, 27798245, 27798459, 27838444, 28077136, 28185529, 28278178, 28285098, 28585210, 28646476, 28673384, 28749784, 28899889, 29045048, 29135585, 29248361, 29748581, 29877610, 30154842, 30347447, 30399195, 30433860, 30678859, 30718791, 31037597, 31154250, 31242268, 31553329, 31570053, 31626788, 31656096, 31707542, 31832026		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	14629465, 19584182, 20460359, 21244662, 22185674, 22217186, 24051404, 27310420, 28077136, 30983550, 31872802, 32125188, 32753620, 36958975, 39354608	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15886225		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	23316287, 30915774	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21474811, 30915774		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	23316287	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	29305337		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	17350295	Associate	★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	22391636, 28156152, 28610651, 29145926		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30632310, 30988703		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	30660810		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	31363056		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21474811, 25465603, 26873941, 28121618, 28278178, 28300429, 29225622, 29877321, 30433860, 31526440		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	30892950		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23588620		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23588620		★☆☆☆☆ Found in Text Mining only
CHARGE Syndrome	CHARGE Syndrome	BEFREE	20389093		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21631924, 28598548, 30696312, 31415396		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	30203371, 31152468		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31115511		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29088261		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29088261		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	33893772	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis Intrahepatic	Intrahepatic cholestasis	Pubtator	33893772	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	27345723	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29593061		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	12702488		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	18787032, 21632119, 9288733		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	22391636, 28156152, 30550563		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	29970253		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	16734391, 19057526, 27622441, 29596446	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	9767543		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20140086, 25010649, 27666945, 28366446, 28797891, 29366406, 29877321, 29980850, 30236068, 30396210, 30829482, 31591375, 9767543		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18222172		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20854423, 21376149, 28596431, 31308239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	27933445, 31038568		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	31038568, 33967621	Associate	★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	17502770, 25304226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic schizophrenia	Schizophrenia	PSYGENET_DG	17502770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	21209035	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	21209035	Stimulate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28692538, 29912265, 30336268		★☆☆☆☆ Found in Text Mining only
Classical galactosemia	Galactosemia	BEFREE	30231941		★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	BEFREE	28197877		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	LHGDN	18769731		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24359504	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28267584		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23799059, 30775986	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	24359504	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	27515676	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21829567, 31356864		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	14732844, 23211301	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15857934, 16775490, 17170030, 18059035, 19221001, 19492417, 21923160, 22193626, 23558862, 27460082, 29427626		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16912864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	17354198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25204550		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	30142858	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17170030, 17591803, 18059035, 19273568, 19760027, 20846476, 21263187, 21720710, 21923160, 23558862, 23593308, 23754448, 24014051, 24700392, 24845032, 24958593, 27072232, 27842582, 29755407, 30142858, 30379922, 30697798, 31506433, 31592340		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17591803		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17591803, 18059035, 21166956, 21263187, 22363134, 23558862, 23593308, 24073224, 27460082, 30379922, 31021558, 31506433, 32053666, 32596369, 34497681, 34876290, 36981858, 37282602	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17660334, 30142858	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27842582	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30142858		★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	9826672		★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	LHGDN	19004982		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	17676984		★☆☆☆☆ Found in Text Mining only
Congenital Generalized Lipodystrophy Type 1	Congenital Lipodystrophy	BEFREE	18640396		★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	29440278		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	17191030		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	17676984		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of ovary	Hypoplasia of the ovary	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	BEFREE	30943548		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19337797, 19919993, 20683677, 28237273, 28255978, 28300429, 28643476, 29359851, 29632154, 30006491, 30154842		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29548819		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20399960, 28543182, 29970669, 31236331, 31371068		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	27151106	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17587397, 25465603, 26769430, 27300270, 27666945, 28121618, 28300429, 28595560, 29278852, 29324260, 29883719, 31113873		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10447228, 33735200	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	11935372		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17587397, 18562207, 20691218, 21584748, 21679057, 25465603, 26457306, 26769430, 27300270, 27666945, 28121618, 28300429, 28314924, 28595560, 29168539, 29278852, 29324260, 29393091, 29453342, 29883719, 30319266, 31113873		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18160586, 20145358, 21176905, 21498926, 27151106, 31872802, 32049202	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18712185, 19473179, 29121163	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17587397, 25465603, 26769430, 27300270, 27666945, 28121618, 28278178, 28300429, 28595560, 29111278, 29121163, 29278852, 29324260, 29883719, 29896248, 31113873		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18381870, 18712185		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	18349107	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	31872802	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	37509115	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	14732844	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	16775490, 18849966, 21829567, 23168838, 28502329, 29287006, 30307540, 31822667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	23168838, 31822667, 33105684	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	25313911, 9253331		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28637727		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12483292, 31582896		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31582896	Inhibit	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29720688, 29794796		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14613274, 17350295, 17502362, 18501560, 20664554, 21935928, 24036528, 24138453, 24582795, 25312721, 26318657, 26751999, 26934480, 27077804, 27648658, 27796618, 27908299, 28053336, 28374624, 28666466, 28690479, 28956662, 29325836, 29620639, 29794796, 29908226, 31137976, 31450004, 31588359, 31781260		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	17443329		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	28495595		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26279362, 26881138, 28421328, 29758945, 30150062, 31539648		★☆☆☆☆ Found in Text Mining only
Dental Diseases	Dental Diseases	BEFREE	28513060		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17275915, 19382181, 23026132, 25629253, 26993304, 27743935, 28197877, 28224268, 28267584, 29190710, 29860945, 30005278, 30236760, 30367065, 30405455, 30562581, 30666218, 30699881, 30870775, 30949073, 31347937, 31404477, 31465895, 31667737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22408745, 22932068, 23026132, 23251447, 25629253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	25629253, 28316984	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	35039097	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27488462		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	17634954	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10022436, 11145919, 12006634, 12087497, 12218345, 12472377, 12495664, 12716787, 12766116, 12882931, 17536157, 18076675, 18263705, 19183309, 19391127, 20153489, 20167575, 20179670, 20690892, 20824098, 20876719, 21209624, 22185674, 23236292, 25059801, 26584826, 26701291, 27450396, 27906690, 27921394, 27923809, 28112680, 28150324, 28197877, 28242305, 28363002, 28413180, 28491119, 28734574, 28951828, 29031395, 29031717, 29108900, 29194996, 29225622, 29304064, 29343656, 29348480, 29351428, 29401605, 29417469, 29492658, 29596446, 29670283, 29777230, 29795184, 29851973, 30004258, 30052309, 30098320, 30287275, 30342966, 30399195, 30409783, 30618559, 30871567, 30890410, 31006835, 31062082, 31231496, 31347024, 31434650, 31499123, 31626814, 31661517, 31783142, 9342538, 9389736		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	16343040, 18696355, 24262292, 28361552, 28942694, 30020508, 36432399	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24954653, 26584065, 27034205, 28050671, 28363002, 28666334, 28846666, 36128550, 36849131	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10022436, 10485707, 11145919, 12006634, 12087497, 12218345, 12472377, 12495664, 12716787, 12766116, 12882931, 17536157, 18076675, 18263705, 19183309, 19391127, 20153489, 20167575, 20179670, 20690892, 20824098, 20876719, 21209624, 22185674, 23236292, 25059801, 26584826, 26701291, 27450396, 27470535, 27906690, 27921394, 27923809, 28112680, 28150324, 28197877, 28228267, 28242305, 28363002, 28413180, 28491119, 28734574, 28743977, 28829491, 28951828, 29031395, 29031717, 29108900, 29194996, 29225622, 29236298, 29304064, 29343656, 29348480, 29351428, 29401605, 29417469, 29492658, 29596446, 29670283, 29704234, 29777230, 29795184, 29851973, 29974394, 30004258, 30052309, 30098320, 30287275, 30342966, 30399195, 30409783, 30534205, 30618559, 30871567, 30890410, 30911344, 31006835, 31062082, 31074113, 31231496, 31347024, 31434650, 31499123, 31626814, 31661517, 31666475, 31783142, 9342538, 9389736		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	10022436, 12006634, 12270921, 12690081, 15070752, 17135604, 18263705, 20167575, 21340154, 22185674, 28256392, 28363002, 32544194, 34937509, 37241229, 38127688	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18050615		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19121992, 31533725	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21549702	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24304572, 28260466, 36218419, 37170809	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	10947884, 12690081, 15070752, 15189365, 21465273, 21709297, 22491740, 24051404, 24102053, 24549597, 26338087, 26829555, 27134129, 27705028, 28413567, 28758947, 30657911, 30764545, 32131811, 32816832, 33617875, 33788629, 34093426, 34589546, 34789800, 35741707, 35883173, 37716291	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25306890	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10877196, 10908288, 16380228, 18955751, 19647774, 20855609, 21105490, 21209624, 21917108, 24304572, 27702650, 28112680, 28336216, 28721140, 28875223, 29722816, 30020457, 30098320, 30120991, 30307540, 30468724, 31110527, 31199772, 31443415, 31743040		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10224179, 10989952, 11140377, 11145919, 11335776, 11895468, 12209150, 12218380, 12690081, 12882931, 14724732, 15070752, 15109449, 16050950, 16257499, 16778581, 17536157, 17553627, 18197594, 18438653, 18490929, 18564365, 18805913, 18828733, 18854428, 19183309, 19489767, 20200337, 21262584, 21289260, 21422926, 21427225, 21938427, 22189999, 22215535, 22457810, 23879520, 24051404, 24102053, 24206404, 24549597, 26614846, 27036040, 27235022, 27380451, 27470535, 28207876, 28229278, 28267584, 28285098, 28436331, 28437012, 28437198, 28485496, 28522646, 28604759, 28640843, 28673384, 28686216, 28691147, 28721140, 28734574, 28758947, 28803396, 28851737, 28979697, 29021828, 29081791, 29108900, 29190710, 29205013, 29256014, 29269073, 29343656, 29374794, 29417469, 29453672, 29479862, 29596446, 29635505, 29785210, 29795184, 29867443, 29877321, 29896248, 29933718, 29967793, 30052309, 30131766, 30428550, 30447052, 30657911, 30762811, 30841005, 30871567, 31013892, 31079115, 31154250, 31363374, 31404477, 31408894, 31461078, 31484347, 31535419, 31539648, 31626814, 31688578, 31832130, 8635660, 8636448, 8810296, 9013743, 9116912, 9342538, 9690055, 9828912, 9867085, 9916864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15070752		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17445536, 17850913, 18779635		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	19391127		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	26614846	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	28112679, 30053313		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21422926		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	29358881	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29168186		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20443680		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	34097736	Associate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	16775490		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Leprechaunism syndrome	BEFREE	29226618		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Donohue syndrome	Pubtator	34718628	Associate	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10368796, 17618952, 28749784		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10368796	Inhibit	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34545294	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10364481, 21555376		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	22350661		★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	20016047, 26915772, 27649665, 33762520	Associate	★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	LHGDN	18226448		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	15983199, 18670142		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17097184, 19727665, 20562674, 25047893, 28131832, 28840618, 29704234, 30010621, 30660196, 31153461, 31549892, 31593246		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	18769731, 31000363	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	18805913, 24549597		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23418565		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	12727933, 28933969, 29631553, 31125904, 31156489, 9857981		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	16860862, 16870954, 18958929, 20050765, 23274423, 28875223, 29109760		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31739649		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	15497495, 9253331		★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	9826672		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16728588, 18988190, 22038736, 22327423, 25171477, 28659656, 29297146, 29559794		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	31602590		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19154413, 22038736, 25171477, 25811593, 28659656, 32531934	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11994543, 15465848, 23184927, 26242176		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	11994543, 12773447, 16269446, 17706208		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17255327, 18958774, 26242176	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30473626		★☆☆☆☆ Found in Text Mining only
Epididymitis	Epididymitis	BEFREE	31006165		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27522536, 29679911, 30092488, 30185147, 30319532		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30530136		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	24982243	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19765303, 23551967, 28002999		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	11694654		★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28259721		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	10539824, 12571619, 17086020, 17114907, 24171506, 25475696, 28448190, 9622134, 9832173		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22218754, 24171506	Associate	★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	9826672		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Familial generalized lipodystrophy	Lipodystrophy	BEFREE	10485707, 16435205, 20097706, 23024365, 23362058, 27906690, 28502512, 31314093, 31656096, 31708526		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	16740977, 25857300, 28285359		★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	10999791, 16320084		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 1	Partial Lipodystrophy	BEFREE	12766116		★☆☆☆☆ Found in Text Mining only
Familial Partial Lipodystrophy, Type 2	Partial Lipodystrophy	BEFREE	30165155		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	12661780, 19716478, 23839791, 24525044, 25554529, 27712037		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	17505564, 22171144, 22215535, 31842467, 35549673	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	17652166, 21151569, 22530350, 22981538, 23024365, 23651953, 25415231, 28358008, 29089335, 29129025, 29507217, 29575696, 29660503, 30052309, 30424542, 30870482, 31071311, 31167890, 31564684, 31708526, 31842467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	LHGDN	18473416, 18753993		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	35677722	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	17032406, 17294310, 22768838, 25501551, 27997977, 28281237, 28596431		★☆☆☆☆ Found in Text Mining only
Fetal Malnutrition	Poor fetal nutrition	BEFREE	30116155		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	28010141		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17032406, 20564215, 23295202, 27709831, 28962213, 29054053, 29197497, 29248466, 29548749, 30079841, 30231008, 30336268, 30818874, 31367862		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30240347		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	24415571	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30911572		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29226876		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27211817		★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	28514906		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	10422768, 11025360, 11787760, 15024038, 16015682, 18181030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	BEFREE	17167154, 17436104, 26559190		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	23529020		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	24569475	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	29760351		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	31791361		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	23089140	Associate	★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	9288733		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10940488, 21771332, 22133921, 28938545		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19775291, 21771332, 30803210, 32526957	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10940488, 21771332, 22133921, 28938545		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24161825		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30803210	Associate	★☆☆☆☆ Found in Text Mining only
Glut1 Deficiency Syndrome	GLUT1 Deficiency Syndrome	BEFREE	31349661		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	20016047	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	14764816, 15886250	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	22179449		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	22179449		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	BEFREE	24625355		★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26747525	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	22764185	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	26338087	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12559213, 29784904	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19919993, 20683677, 28237273, 28255978, 28643476, 29359851, 29632154, 30006491, 30154842		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	19919993, 22764185, 29907861, 30006491	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	19634986, 20149225, 25583406		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	23047069		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26077362		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	16103628		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	17006991	Associate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	32968152	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	25985182	Associate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	20149225	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23058473, 23418565	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	30650445	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22171144	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	16489668, 17540037, 22171144	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19697123, 21239736, 23228483, 24377502, 27177292, 33019728	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28270386	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31022919		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29304064, 30225886		★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	28801090		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	15476444		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19548952, 25904208, 29304064, 30225886		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	19246519, 9288733		★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	19246519, 9288733		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	21616679, 26190448, 28982658, 29088261		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	25086370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	19489767, 19647774, 20855609, 21209624, 21616679, 25034792, 26584826, 27126637, 27788523, 28112679, 28640857, 28641783, 28743458, 28888461, 29190687, 29438473, 29857041, 29974394, 30698681, 30792083, 30988006, 31391467, 31496784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	19716478, 21561152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	25800063, 27340502, 31947745, 35334523	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	29440278		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10022436, 10833328, 11110887, 11113606, 11335776, 11516999, 11596667, 11678825, 11956242, 12411472, 12882910, 12890573, 14642624, 17653093, 18559540, 19647774, 19685554, 21209624, 21427225, 21852675, 22664497, 28640857, 28749784, 29337272, 29953915, 30471995, 30664851, 30884480, 31121198, 31265057, 31398626, 31626814, 9177239, 9330585, 9360558, 9529971, 9753302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	10022436, 18559540, 18769731	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	LHGDN	12690082, 15533361, 18404969		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	25306890	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	9826672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	12393845, 15472169, 26984935, 29088261, 29296187		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	16285998		★☆☆☆☆ Found in Text Mining only
Hyperostosis	Hyperostosis	BEFREE	12056872		★☆☆☆☆ Found in Text Mining only
Hyperostosis Frontalis Interna	Hyperostosis Of Skull	BEFREE	12056872		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	24468228, 27611607, 28730419		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	28730419		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	27134129	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperprolactinemia	Hyperprolactinemia	BEFREE	26682995		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	15340103, 18769731, 19204185, 19562039, 19772655, 21465273, 21918574, 21920718, 22218754, 24171506, 24485307, 26694100, 29338791, 36157437	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	16785148, 23535989	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	10981165, 10999797, 11872379, 12050272, 12219869, 14739355, 15611783, 16785148, 17114907, 17211240, 18923972, 19093712, 19204185, 19229195, 19382181, 22218754, 22293279, 23688012, 24171506, 24485307, 24487982, 25475696, 26103132, 27226618, 27450396, 27613336, 27666945, 28233236, 28419227, 28551830, 28720877, 28824433, 28982776, 29093301, 29135585, 29179226, 29184046, 29201221, 29338791, 29562733, 29635288, 29883719, 29957022, 30582364, 30628058, 30678859, 30856361, 30896657, 30911344, 30923189, 30940525, 31042407, 31087350, 31236708, 31330870, 31357197, 31545149, 31657510, 31659606, 31691260, 9622134, 9814618, 9832173, 9886890		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	11800057, 12484512, 18050615, 18596833, 19204185		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	12050272, 16827954, 25205467, 27226618		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	10365683, 28097455		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	29436483	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	24485307	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	12238635	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	40128964	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28829491		★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	BEFREE	10523015, 18854428, 20382689, 28366446, 28648620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	CTD_human_DG	15070752, 9500540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	Pubtator	15070752, 18854428, 21340154, 26336809	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	CTD_human_DG	15070752, 9500540		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	12087499, 23275530, 29887939, 29948931, 31402895		★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG	15070752, 9500540		★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	26278057	Associate	★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	31357197	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	10365683, 27793676, 28144955, 29175438, 30943548, 31004687		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	LHGDN	17693966		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16533767, 17591803, 17609976, 18696355, 21448846, 25312721, 25573199, 25889814, 36530571	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17049073, 20569445, 22866899, 30257286, 31935962	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	BEFREE	31580838		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31345155		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	30622656	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	28536758		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25745038, 28604281		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31324858		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	11726531, 15159310, 20185531, 28053336, 29747813, 9732873		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	29950524	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	LHGDN	15059070, 16774845		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11427484		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18358569, 28267584, 28821446, 28990588, 29492658, 30400097, 30692905, 30893833		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	18958774, 30231941, 34407095	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	27813378	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	14732844, 33159578	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23211301, 28611344, 29033577, 29086333, 29545852, 30602159, 31779136		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27488462		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	11591788, 18854428, 20711963, 21340154, 21918574, 21920718, 23349940, 23593308, 26420861, 27034205, 27515676, 28027637, 28542631, 28758947, 31914480, 32544194, 34645953, 36128550, 37853077, 39180924, 39692030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22491740, 25306890	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27342408	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	18263705, 9389736, 9753302		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	23335226, 31408735, 36293132	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29372627		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	24441571	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	16437696	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23737651		★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	23316287	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	30796846		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	21042009		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	29358881	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic Attack Transient	Transient ischemic attack	Pubtator	21176905	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26873941, 28121618, 29217361, 31526440		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	10594516, 22350661, 26915772, 28596789		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28415953		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	11531922		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28112679, 29438473		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18534134		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	20140086, 25010649, 27588900, 30117101, 31691260		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20140086, 31566104	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	10431029, 18242170, 9767543		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	20140086, 27134129, 9767543	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	14681862, 16756630		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	9767543		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18787400	Stimulate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	24485307, 28233236		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35598777, 36771423	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	37327675	Associate	★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	10485707, 10523015, 11595779, 12086940, 12393845, 12403081, 12519870, 15070752, 17684509, 19713740, 19919993, 20458342, 21340154, 21593110, 22665330, 23026132, 23374894, 23382191, 24703486, 25232148, 26313897, 26584826, 27324433, 27488462, 27588900, 28007844, 28606728, 28648981, 28702474, 28796527, 29438473, 29950524, 29996141, 30021121, 30370487, 30475221, 30845123, 31357197, 31483094, 8886745, 9177239, 9243102, 9537324		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	UNIPROT_DG	25551525, 9500540		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	ORPHANET_DG	26567097		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
LEPTIN RECEPTOR DEFICIENCY	LEPTIN RECEPTOR DEFICIENCY	BEFREE	11864851, 17229951, 25098764, 29568105		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10784389, 17072067, 20823291, 22082804, 23741006, 28193268, 29620639		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17072067	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10029596	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10029596, 33485366, 37237325	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17072067	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12031914		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16103628, 19665393, 20372853, 21955253		★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	BEFREE	30174195		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18855010, 31021458		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31026583		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	10037260, 28339344		★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	10559671		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	10037260, 12676562, 16682936, 18076675, 19727665, 19892886, 20061300, 20097706, 20964254, 23024365, 23651953, 25047893, 26313897, 26584826, 27497155, 27906690, 28032897, 28088613, 28324110, 28339344, 28448764, 28502512, 28993984, 29155136, 29723161, 29788076, 30010621, 30021121, 30098320, 30370487, 30475221, 30539782, 30657911, 31071311, 31135595, 31222048		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	12713059, 15983199		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	20616664	Inhibit	★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	26336809, 35524481, 35733784	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	18076675, 18640396	Inhibit	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Congenital Generalized	Lipodystrophy	Pubtator	23362058, 31822667, 34213454, 37347108	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	18076675	Associate	★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	34168618	Inhibit	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	11406655, 19558598		★☆☆☆☆ Found in Text Mining only
Lipomatosis	Lipomatosis	Pubtator	34187516	Stimulate	★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	11406655, 19558598		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	11406655		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14976221, 15300888, 16310278, 17543459, 18473418, 20723213, 20941777, 24703486, 25704884, 26639061, 28452232, 29891303, 30718259, 31499123, 31842467		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15300888, 18473418		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	15104370, 17344504		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28692538, 29912265, 30336268		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	17060687	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	24259947	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24259947	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14976221, 17543459, 24703486, 25704884, 26639061, 31842467		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12200109		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25027400, 35225464	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26593227	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	27588900, 28409523		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19811274	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25989537, 26385092, 28244652, 34646335	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	27588900, 28409523		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18196243		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25383655, 26385092, 26790188, 27588900, 28244652, 28409523, 28795654, 29302804, 29954279, 30098476, 30169503, 31094570, 31707542		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25345756	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28898254		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	27588900, 28409523		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17006991, 30142858, 32363657	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24548863, 25171477, 36941557	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	27366905	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11694654		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16160698	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16160698, 25778326		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	15159310		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15159310, 15894681, 16160698, 24845032, 25536622, 25778326, 30697798		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24845032, 25778326		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	LHGDN	16936761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	26742925, 29049554, 29176959, 29870819, 30005278, 30071417, 30554862, 30562581, 30666218, 30878306, 31230885, 31354416, 31465895, 31669792, 9754619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	9754619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	15955844		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	21771332		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10364481, 10719061, 11369444, 11911959, 12734209, 15138597, 15475434, 16011872, 16206269, 16504019, 16525650, 16533767, 16609020, 16752079, 17409452, 17653093, 18004080, 18262553, 18559540, 18668212, 18715880, 18821585, 18945363, 19017403, 19047149, 19408304, 19661131, 19697123, 19723917, 20032412, 20171193, 20193256, 20410173, 20658737, 21163886, 21516303, 21574190, 21698367, 21731759, 21840575, 21887553, 21947707, 22200873, 22490496, 22664497, 22800822, 22983835, 23162077, 23199901, 23228483, 23254958, 23358729, 23412922, 23869900, 24114531, 24176089, 24377502, 24716804, 24738610, 24825736, 24932998, 25482303, 25510398, 25721149, 25846733, 26121010, 26260992, 26286584, 26359358, 26407154, 26556856, 26696367, 26825898, 26899873, 27082857, 27177292, 27914811, 27926517, 27999190, 28188108, 28190851, 28565832, 28571770, 28714000, 28770546, 28938640, 28983080, 29048637, 29056512, 29088874, 29121911, 29254161, 29311755, 29336592, 29433827, 29869823, 29979411, 30116331, 30293548, 30397604, 30404206, 30417207, 30563531, 30634494, 30702563, 30856610, 30899280, 31015393, 31292496, 31380268, 31491560, 31538300, 31671408, 31756890, 31844100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21353530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16728588, 18988190, 22038736, 22327423, 25171477, 28659656, 29297146, 29559794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27211817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	11053255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31003933		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15300888		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16630717, 23430445, 24512731, 25027400, 28160559, 31119158		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18855010, 31021458		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15522945, 22343039, 23262295, 28104444, 29976638, 30450532, 31077012		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25948792, 27780823, 27999190, 29719602		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11552710, 15042602, 15093720, 15452447, 16803678, 18718531, 23754448, 26376613, 27699825, 27768592, 29115533, 29299904, 29465157, 30186533, 30483810, 31147627, 31671654		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	15042602		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17006991, 17590101, 23178499, 23354307, 24548863, 28316984, 30078770, 30449153, 31444698		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20428831, 27050378		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14972512, 29602840		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12943459, 15042602, 15452447, 16085355, 16504019, 16630717, 16728588, 16951207, 17590101, 18004080, 18855010, 19221001, 19408304, 19492417, 20008098, 20045163, 20443680, 20846476, 21750869, 21771332, 21851341, 21952038, 22082804, 22133921, 23269222, 23564622, 23588620, 23593308, 23688008, 23754448, 23869900, 24014051, 24146750, 24845032, 25171477, 25252917, 25536622, 25704884, 25809704, 25948792, 26077362, 26260992, 26286584, 27177292, 27780823, 27842582, 28069486, 28123583, 28193268, 28215174, 28454352, 28459203, 28542577, 28628401, 28729467, 29115033, 29158066, 29197678, 29427626, 29516906, 29682217, 29695916, 29955847, 29991082, 30145771, 30218381, 30338797, 30397604, 30610844, 30659329, 30670780, 30697798, 31003933, 31114233, 31119158, 31196966, 31289528, 31380268, 31439906, 31559898, 31789415, 31794851		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23588620		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15857934, 16775490, 17170030, 18059035, 19221001, 19492417, 21923160, 22193626, 23558862, 27460082, 29427626		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	17354198		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	11726531, 19957188, 20016054, 21670064, 25516614, 28054344, 28069486, 28285098, 28794412, 29054611, 29116252, 29358937, 29800288, 29868503, 30089153, 30180300, 30534129		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	17355247	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21353530		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10364481, 16206269, 16825198, 18715880, 19408304, 19723917, 20193256, 21555376, 22200873, 22270359, 26036628, 29249690		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12054648, 12687277, 12734209, 15240518, 16009333, 16533767, 16609020, 17344214, 17653093		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21353530		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21353530		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	26095599	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19713740, 28637727, 31263961		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37481560	Inhibit	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29660031		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	30488610		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17275915, 19382181, 23026132, 25629253, 26993304, 28197877, 28224268, 29190710, 29860945, 30005278, 30236760, 30367065, 30405455, 30562581, 30666218, 30699881, 30949073, 31347937, 31404477, 31465895, 31667737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22408745, 22932068, 23026132, 23251447, 25629253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	31420734		★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	LHGDN	17558893		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	11145919, 11469718, 12582458, 16622580, 18490929, 18641923, 19182739, 25143632, 26535443, 27906690, 28348560, 28951828, 29205013, 29343656, 29427376, 29670283, 29759068, 29910742, 30071417, 30084652, 30390288, 30390289, 30821426, 30889844, 31141984, 31154250, 31408957, 31495688, 31656096		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	18076675	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	LHGDN	18490929		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	20711963, 21852675, 22545089, 24498038, 26504811, 27101398, 31067764, 32936762, 34407095, 35436409, 36834493, 39354608	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21498926, 36597718	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	21918574, 22185674, 22217186, 22734460, 27310420, 27681143, 27966294, 28077136, 30356143, 34016094, 34205732, 35627229, 36117520, 37171229, 39837875	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10539824, 11283790, 12582458, 15336575, 15960859, 15978856, 16125798, 16202847, 16249458, 16684122, 17211240, 17372303, 18071340, 18299466, 19685554, 19844182, 20478430, 20591628, 20690892, 21147642, 21569107, 21574190, 21616679, 21670064, 21918574, 22185674, 22269963, 22734460, 23688012, 23817596, 23832168, 24297487, 24549138, 25084549, 25916157, 26083812, 26621002, 27310420, 27470535, 27550773, 27564309, 27788523, 27832021, 28065828, 28077136, 28120564, 28139438, 28193268, 28342901, 28439190, 28511904, 28577342, 28721146, 28747790, 28875764, 28878827, 28879574, 28980344, 29020116, 29115033, 29132244, 29205013, 29205099, 29205515, 29206867, 29225622, 29271068, 29335849, 29410303, 29441581, 29580071, 29625373, 29759068, 29788076, 29954279, 30037593, 30054704, 30114249, 30309709, 30338401, 30381540, 30530892, 30642114, 30753255, 30792083, 30807250, 30813240, 30832279, 30832310, 31118157, 31137976, 31151171, 31154250, 31249528, 31284400, 31311491, 31341853, 31408957, 31661671, 31783662, 9828912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16793964, 18515891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	BEFREE	27165492, 28108291, 28270183, 28677995, 28922461		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	27165492		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29867443, 30775986		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	22995745, 29160594		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	19763737	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37542585	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30196837		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	29358881, 31016867		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	31130833		★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	28572069		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	29121911		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19665393, 28490813		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24841155	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27863383	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15788534, 21078910, 21664965, 27105071, 29320952, 29525910, 29581230, 30196837, 30219158, 31550559, 31563075, 31704454		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24098530	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	24098530	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	LHGDN	15324935		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	15788534, 31704454		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	16734391	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	17627820		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16103628		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37237325	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29570794		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10485707, 22082804, 31656096		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21176905, 24549597	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24549597, 26769430, 27487851, 29748581		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	19919993	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24549597, 32544194	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	32933141	Stimulate	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	14592354, 16944669		★☆☆☆☆ Found in Text Mining only
Narcolepsy-Cataplexy Syndrome	Narcolepsy-Cataplexy Syndrome	BEFREE	14592354		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20422702		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35628510, 35778755	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10559671, 11053255, 11406655, 11422113, 14633625, 15138597, 15452447, 15570044, 15857934, 16310278, 16504019, 16533767, 16684834, 16825198, 17006991, 17409452, 18945363, 19221001, 19299541, 19665393, 19713740, 20045163, 20193256, 20647974, 20941777, 21263187, 21574190, 22490496, 22800822, 23162077, 23869900, 24569475, 25252917, 25704884, 25948792, 27082857, 27842582, 27866828, 27914811, 28118269, 28188108, 28192065, 28257446, 28414093, 28426873, 28454352, 28543182, 28565832, 28729467, 28938545, 29158066, 29212223, 29299904, 29345342, 29413587, 29427626, 29559794, 29566065, 29979411, 30135180, 30142858, 30174195, 30397604, 31119158, 31442303, 31444698, 31471106, 31738032, 9753302		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	11489141, 29464548		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	12898374, 15782310		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29731827		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30106375		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23132673		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	23132673	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21983012, 24874077, 28768997, 31085646		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21983012	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30911572	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28819795, 28987937, 30092488, 30386207, 31130833, 31447640		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	29959804		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	29959804		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	BEFREE	30488610		★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	30986512		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18713300, 22215535, 22530350, 24161595, 24716593, 26858440, 27164963, 28086768, 28146130, 28257515, 28443702, 28596431, 28758929, 28759939, 28962213, 29156528, 29158088, 29312569, 29338271, 29660503, 29974828, 30032465, 30052309, 30266576, 30541001, 30818874, 30882489, 31085402, 31204416, 31311491, 31645151, 31750276, 31756645, 31765666		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	24211274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16630717, 29566065, 31119158		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	15886250, 27926517, 28705737		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	17032406, 19735301, 27709831, 28257515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	24211274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15864111, 28719155, 30660810, 31121198, 31496784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	15864111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nuchal bleb, familial	Nuchal Bleb	BEFREE	16285998		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10022436, 10098508, 10102052, 10207720, 10224179, 10333553, 10366820, 10368796, 10382588, 10395194, 10661913, 10738535, 10841005, 10855527, 10923636, 10971791, 10997652, 11006314, 11015599, 11022201, 11079733, 11103212, 11118025, 11140377, 11145919, 11151766, 11175734, 11238509, 11281277, 11283790, 11315829, 11444591, 11461187, 11516999, 11554778, 11595526, 11595779, 11596667, 11600552, 11702849, 11743131, 11757823, 11795261, 11864851, 11872379, 11898393, 11956242, 11978668, 11979399, 12050272, 12087499, 12087500, 12119665, 12165582, 12209150, 12219869, 12393845, 12403081, 12481551, 12519870, 12531555, 12536356, 12559771, 12582458, 12609752, 12634434, 12690081, 12765970, 12815275, 12882910, 12915696, 14506902, 14601134, 14724732, 15070752, 15159310, 15202783, 15452447, 15505633, 15520383, 15536594, 15569818, 15576490, 15601956, 15636422, 15677760, 15788447, 15790575, 15833934, 15856064, 15893114, 15910756, 15937081, 15972940, 15996173, 16011872, 16112275, 16206269, 16285998, 16333525, 16396852, 16403817, 16432543, 16571841, 16608891, 16609020, 16627866, 16740977, 16762576, 16822822, 16944669, 16952706, 16971225, 17005171, 17027833, 17031518, 17060929, 17097687, 17098302, 17114907, 17161337, 17170030, 17191030, 17266635, 17350295, 17378367, 17425664, 17502873, 17509633, 17553627, 17555952, 17587397, 17591803, 17618952, 17653093, 17728393, 17909621, 17922949, 17937601, 17940414, 17952632, 17979776, 18070757, 18197594, 18252898, 18273796, 18299466, 18308368, 18317470, 18397542, 18559540, 18604373, 18715880, 18716353, 18716356, 18725053, 18802216, 18805913, 18828732, 18846048, 18855084, 18923972, 18927547, 18945363, 19142102, 19182739, 19190071, 19427251, 19489767, 19536667, 19647774, 19713740, 19723556, 19733160, 19735301, 19747414, 19760027, 19772655, 19808018, 19812053, 19817705, 19840239, 19910644, 19913498, 20032412, 20051227, 20059985, 20086094, 20127379, 20140086, 20156757, 20174754, 20183928, 20206200, 20303124, 20304616, 20307995, 20382689, 20399960, 20455195, 20500101, 20520958, 20540750, 20597904, 20642443, 20683677, 20690892, 20842437, 20846476, 20846876, 20888253, 20945385, 20970834, 20977819, 21037323, 21105285, 21111705, 21181202, 21289260, 21296922, 21340154, 21419406, 21499988, 21510767, 21514177, 21555376, 21574190, 21595595, 21606602, 21622208, 21660081, 21755292, 21917108, 21921635, 21952038, 22005719, 22020349, 22038736, 22058035, 22093833, 22128019, 22185674, 22193626, 22218754, 22327423, 22350661, 22496743, 22607892, 22641000, 22734460, 22768838, 22800822, 23054910, 23115175, 23168838, 23228483, 23236292, 23254958, 23256448, 23266707, 23272802, 23285241, 23349940, 23359004, 23374894, 23428692, 23436919, 23593308, 23624317, 23652383, 23652556, 23688012, 23722910, 23723060, 23751306, 23756832, 23824601, 23869900, 23879520, 23884163, 23954230, 23958651, 24014051, 24025407, 24035996, 24036528, 24051404, 24084737, 24102053, 24138453, 24171506, 24204914, 24212090, 24289790, 24307561, 24308887, 24319309, 24394757, 24402012, 24426828, 24487982, 24512731, 24549138, 24582795, 24690978, 24738610, 24870721, 24899470, 24932998, 24947733, 24954653, 24956416, 24958593, 25004093, 25034151, 25117807, 25171477, 25232148, 25299465, 25449029, 25516614, 25551525, 25641693, 25721149, 25733497, 25740294, 25791136, 25800063, 25857300, 25879793, 25929254, 25958349, 25984632, 26036628, 26054710, 26064921, 26103132, 26150485, 26186301, 26233872, 26255942, 26313897, 26333398, 26359358, 26381270, 26701291, 26730935, 26742925, 26780438, 27008407, 27075752, 27177292, 27196486, 27211817, 27240985, 27313173, 27337945, 27366905, 27381457, 27407136, 27487851, 27488462, 27528227, 27623943, 27629594, 27677429, 27704310, 27706562, 27709831, 27743935, 27752061, 27788523, 27791019, 27838444, 27841944, 27842582, 27867203, 27886379, 27905126, 27906690, 27921394, 27933445, 27939689, 28027637, 28028849, 28073831, 28076762, 28093305, 28128972, 28139438, 28156152, 28170448, 28182687, 28183093, 28226031, 28232667, 28233273, 28241462, 28245454, 28249041, 28263381, 28270795, 28271035, 28321032, 28332170, 28336216, 28342901, 28343310, 28374624, 28393393, 28402851, 28409494, 28411906, 28414093, 28416193, 28421328, 28436331, 28472252, 28477438, 28484364, 28500829, 28506466, 28509827, 28513060, 28542577, 28542631, 28549558, 28561185, 28585208, 28585209, 28586744, 28601299, 28615667, 28627656, 28628399, 28637727, 28645299, 28648981, 28659656, 28686191, 28705795, 28722317, 28735903, 28750045, 28758929, 28758947, 28763297, 28768997, 28770546, 28801068, 28809927, 28860773, 28861689, 28864114, 28886551, 28912580, 28924523, 28934139, 28952460, 28956662, 28957383, 28959235, 28973533, 28975585, 28990588, 29027317, 29048637, 29051043, 29081791, 29089335, 29089444, 29093685, 29101672, 29104286, 29108900, 29130652, 29135585, 29155039, 29174427, 29176959, 29196758, 29199407, 29205099, 29205916, 29212170, 29222412, 29230967, 29234017, 29236298, 29241578, 29246653, 29252076, 29268651, 29271068, 29273197, 29295491, 29299904, 29311635, 29311755, 29314270, 29321684, 29322840, 29329236, 29337272, 29343656, 29367725, 29381374, 29394163, 29397535, 29410008, 29412799, 29417469, 29427626, 29447215, 29464548, 29479862, 29507217, 29514392, 29527116, 29562733, 29565180, 29575696, 29602840, 29618984, 29632154, 29635288, 29649778, 29670283, 29675134, 29686012, 29706935, 29719602, 29720688, 29752338, 29760351, 29763838, 29784904, 29789721, 29795184, 29800288, 29852166, 29868503, 29883788, 29885866, 29887939, 29891216, 29891714, 29893028, 29893663, 29907930, 29949600, 29955847, 29961406, 29978352, 29979411, 29991082, 30032721, 30041557, 30060995, 30071417, 30084652, 30106108, 30131073, 30135249, 30154842, 30174020, 30174195, 30179726, 30218381, 30252189, 30277920, 30283080, 30285146, 30287258, 30294896, 30309268, 30309709, 30324498, 30324835, 30338401, 30342966, 30357355, 30372704, 30379922, 30390288, 30390289, 30399374, 30422702, 30423168, 30428550, 30441779, 30464233, 30473626, 30475221, 30530892, 30537704, 30539926, 30551684, 30563501, 30569635, 30628058, 30634494, 30638935, 30649593, 30662654, 30664741, 30678859, 30692905, 30732639, 30773418, 30789753, 30807250, 30821426, 30832310, 30833749, 30841005, 30842678, 30843931, 30856361, 30877623, 30896657, 30897853, 30926645, 30935076, 30940525, 30959481, 30988703, 30995667, 31006983, 31015582, 31022919, 31062082, 31074113, 31077337, 31079115, 31090824, 31091785, 31118047, 31129049, 31130918, 31139935, 31141984, 31146419, 31154250, 31167202, 31167880, 31173888, 31174304, 31191220, 31204527, 31220580, 31222048, 31237951, 31242268, 31257412, 31259669, 31263961, 31285522, 31289528, 31311115, 31316526, 31336913, 31338735, 31341853, 31347937, 31357197, 31364017, 31372167, 31380268, 31386565, 31408896, 31439906, 31454257, 31483094, 31484347, 31491560, 31494654, 31495688, 31499123, 31509751, 31509948, 31533725, 31551485, 31553329, 31557979, 31562952, 31577926, 31590062, 31605363, 31609518, 31639770, 31656096, 31661517, 31682617, 31688081, 31694146, 31697751, 31717265, 31726089, 31749764, 31773771, 31805276, 31809868, 31832130, 7585224, 8532024, 8635660, 8636448, 8692618, 8770941, 8810296, 8826985, 8886745, 8990865, 9013743, 9144432, 9177239, 9231657, 9243102, 9326333, 9329741, 9342538, 9357929, 9389736, 9405031, 9434056, 9467001, 9506746, 9516053, 9529971, 9537324, 9600917, 9619341, 9622134, 9623983, 9625082, 9625380, 9730492, 9745435, 9748302, 9751754, 9754619, 9763877, 9812905, 9828912, 9829217, 9842990, 9857981, 9859024, 9860295, 9867085, 9886890, 9924798, 9931161		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	10022436, 10029596, 10348493, 10368796, 10388699, 10834292, 10919945, 11171593, 11591788, 11595779, 11786597, 12270921, 12634434, 12690081, 14734764, 15070752, 15197684, 15497495, 15833934, 15869602, 15937081, 16222047, 16571841, 16734391, 16968396, 17135604, 17559672, 17591803, 17639020, 17660334, 17702747, 17986612, 18273796, 18317470, 18769731, 18787032, 18846048, 18927547, 18945363, 18972601, 19247278, 19564704, 19584182, 19688109, 19697123, 19717488, 19772655, 19849856, 20051227, 20059770, 20140086, 20383037, 20500101, 20502402, 20534145, 20642810, 20738880, 20825686, 20858286, 20887884, 21163886, 21239736, 21465273, 21673435, 21755292, 21852675, 22038736, 22185674, 22218754, 22237063, 22282662, 22362819, 22411388, 22545089, 22734460, 22748134, 22797372, 22837379, 22968658, 23115175, 23168838, 23228483, 23261058, 23300886, 23318644, 23335226, 23512807, 23593308, 23856194, 23975165, 23988172, 24051404, 24073224, 24081229, 24171506, 24289790, 24319006, 24319309, 24360890, 24426828, 24427296, 24636574, 24690978, 24707501, 24947733, 25132099, 25171477, 25299465, 25306890, 25370852, 25379721, 25403445, 25423261, 25448795, 25450293, 25488447, 25721149, 25800063, 25857300, 25929254, 26053184, 26064921, 26095599, 26179253, 26185753, 26186301, 26260992, 26338087, 26472474, 26636769, 26637991, 26694100, 26829555, 26865587, 26886906, 27015185, 27037668, 27075752, 27134129, 27177292, 27241181, 27421018, 27622441, 27706562, 27774962, 27780823, 28027637, 28096764, 28195351, 28360946, 28377240, 28393393, 28453173, 28542577, 28542631, 28630279, 28686191, 28758947, 28768997, 29049554, 29217499, 29234017, 29250671, 29370782, 29389973, 29550824, 29596446, 29668472, 29681516, 29752338, 29893028, 29907861, 29950524, 30021629, 30350805, 30379922, 30442103, 30563501, 30732639, 30746959, 30764545, 30926952, 31029506, 31067764, 31119158, 31285522, 31506433, 31533725, 31580718, 31661820, 31871931, 31878053, 31914480, 31983119, 32004678, 32053666, 32125188, 32153512, 32260113, 32392278, 32398726, 32544194, 32798443, 32917775, 32968152, 33019728, 33051459, 33179511, 33221380, 33369280, 33485366, 33617875, 33983957, 34097736, 34205732, 34620218, 34642196, 34773742, 34821371, 34876290, 34884678, 34964707, 35022422, 35031012, 35092386, 35104295, 35326405, 35334523, 35457174, 35574020, 35627568, 35654930, 35677722, 35703718, 35710817, 35741707, 35886710, 35898454, 35937803, 36043953, 36098275, 36121795, 36126070, 36142638, 36151575, 36293132, 36369476, 36479220, 36619235, 36722225, 36773522, 36921085, 36981858, 37000968, 37155466, 37231745, 37237325, 37282602, 37329217, 37489486, 37509115, 37716291, 37853077, 37888144, 37892180, 37901192, 38003551, 38127688, 38172514, 38504134, 39203789, 39457458, 40128964, 40246357, 40565190, 8532024, 8954050, 9450849, 9466322, 9555938	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	10385485, 14629465, 14985328, 17425664, 18787400, 19047149, 20032412, 20711963, 22217186, 22773729, 24262292, 24885899, 25186264, 25967962, 26513002, 27366905, 27465935, 27677832, 27705028, 28274232, 29073286, 29737494, 29784904, 30572569, 31664059, 33914321, 34202165, 34457110, 35111163, 35866593, 36402758, 36455260, 37455922, 37901192, 38029922, 39837875, 40292473, 9054474, 9153282, 9385614, 9618121	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16322796, 28729389, 36131285, 36512575, 36849131	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	17517446, 18515891, 19913045, 20122948, 23839791, 24042701, 25086370, 25551525, 25554529, 26186301, 28698385, 9202122, 9502777, 9826672		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	26808524	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	28738359, 31914480, 36619235	Associate	★☆☆☆☆ Found in Text Mining only
Obesity due to congenital leptin deficiency	Obesity	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Obesity Morbid	Obesity	Pubtator	15070752, 18854428, 21340154, 22734460, 28377240, 31067764, 36619235	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	37266430	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	10523015, 10673363, 11140377, 12033286, 12481551, 12519870, 15070752, 15711637, 15937081, 17122358, 17728393, 18854428, 19820018, 21151569, 22463805, 23722910, 23799059, 24707501, 25143632, 26179253, 26313897, 27313173, 29040067, 30131311, 30309709, 31067764, 31210052, 31739166, 9150718, 9537324, 9545018		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	CTD_human_DG	15070752, 9500540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	18821585, 28565832, 30897853		★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	29970253		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	29748581, 31115489		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	CTD_human_DG	16391412		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17350295, 25893833, 26318657, 29908226, 31878053	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17502362, 19215023, 19688109, 20141628, 20534145, 25312721, 26636769, 27716396, 32095874, 37171229	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	34983993	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	20664554, 28013331, 28831581, 29191221, 29335849, 31450004		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	17924050, 23263929, 28116469, 29777277, 31249331		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	29191939		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	19215023, 34818977, 35758378	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	20642443, 21376149, 23460508, 27648658, 28440742, 28448764, 28646476, 29559840, 29696936, 29908226, 30269370, 30305826, 31566247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Diseases	Ovarian diseases	Pubtator	23579009	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30231941		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	LHGDN	15374699		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15522945, 22343039, 23262295, 28104444, 29976638, 30450532, 31077012		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18624749, 22968658, 26053184, 28075407, 29976638, 34884678, 37155466	Associate	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	31292295		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25948792, 27780823, 27999190, 29719602		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30638935		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19051043, 25408239, 27780823, 37555827	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	12138320, 28849043, 31091785		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	LHGDN	18376301		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	28551488		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28551488, 31465895		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	20008098, 20045163, 21750869, 30657911, 30906321		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	24468228		★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	24468228		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	27611607		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31130833		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28765165, 30508418		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27777020		★☆☆☆☆ Found in Text Mining only
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	10999791, 18076675, 28371314, 31314093		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17005171, 19943998, 26333398, 28008865, 28017965, 28542631, 29412799, 30442103, 31253409, 31285522, 31483094, 31845423, 9357929		★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	29760351		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30711174		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	30395653		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	28244652		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	28244652	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	39337647	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25879793, 28662701, 28922461		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33967621	Inhibit	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30738358		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30339059		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	36741233	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30339059		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	17142261		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	23418565	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	21943151	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31738032		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	28551488		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29110608		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	29190687, 31514318		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	29682217		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	29682217		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11006314, 11702849, 14671186, 15497495, 17562334, 17895321, 20500101, 21419406, 21827375, 22381227, 22607892, 22945299, 23769971, 27798245, 28228318, 28332170, 29160594, 29428305, 29430464, 29749830, 30131073, 30623695, 30635060, 30721746, 31516017, 31593246, 31823915, 9619341, 9859024		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12857430, 15533361, 15757855, 17562334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	15497495, 16570705, 21827375, 25423261, 25450293, 30635060, 32283997, 32393090, 33914321, 34407095, 35185786, 35758378, 39692030	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	20500101, 26589977	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	22381227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28911818		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	10368796, 11836343, 11864851, 15691361, 17618952, 25926624, 9357929, 9450849, 9842990		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	29303010, 30325733, 31781033		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12512839		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23741006		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	20157255		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	26279362, 26881138, 28421328, 29758945, 30150062		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	30307540		★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	CTD_human_DG	15070752, 9500540		★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29570794		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	28224268		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11552710, 15042602, 15093720, 15452447, 16803678, 18718531, 23754448, 26376613, 27699825, 27768592, 29115533, 29299904, 29465157, 30186533, 30483810, 31147627, 31671654		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	18958356	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12902351, 17938644, 18958356		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12902351, 18958356, 19035456, 30186533, 31671654, 32894540, 34218595	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	15042602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19035456, 35710817	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21045260, 32573960	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	11095344, 23114743, 27870883		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	28453643		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18173522, 21569107, 26054710, 27488462, 29232663, 29252076, 29432655, 31090824, 31275060		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18173522		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	18547319, 24851032, 33416099	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26095599	Inhibit	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	15864111, 28719155, 30660810, 31121198, 31496784		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	15864111, 19142102		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28604281		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36157437, 40073405	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16135719, 22773729, 22837379, 22881231, 31308239, 37812260	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29524411		★☆☆☆☆ Found in Text Mining only
Rabson-Mendenhall Syndrome	Rabson-Mendenhall Syndrome	BEFREE	23969187		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	29364741		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31425509		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	31425509		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29620639		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31003933		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28543182, 29970669, 31236331, 31371068		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29366406		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31566104		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	11341297, 11928067		★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Retinal Dysplasia	BEFREE	28192065		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10194520		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	LHGDN	18226448		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	18710461		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	17443329		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18501560, 21385539, 23622344, 28053336, 28662934, 29101672, 29187287, 29226077, 29377743, 29620639, 29947997, 30154891, 31223038		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	30951821, 32963497	Associate	★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	29689708		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	29549722		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	26368286	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11694654		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15864111, 18515891, 20591628, 25284335, 25304226, 28315932, 28346888, 29219062, 29275180, 29403343, 29410009, 29524451, 30660810, 30848483, 31118157, 31230885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15864111, 17502770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17285096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	35627229	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	22381227		★☆☆☆☆ Found in Text Mining only
Scleroderma Limited	Scleroderma	Pubtator	27515676	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31667578	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	36670417	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	LHGDN	18007248		★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23558862		★☆☆☆☆ Found in Text Mining only
Secondary Peritonitis	Peritonitis	BEFREE	21943151		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	21943151	Associate	★☆☆☆☆ Found in Text Mining only
Septal hypertrophy	Septal Hypertrophy	BEFREE	28604759		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21943151, 28114167, 28919840, 30618812		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	30848483		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	28513060		★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	28199868		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	28402255		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	21448846, 28744834		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Central	Sleep apnea	Pubtator	24030529	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	18204169, 32968152, 38172514	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	15611783, 28195016, 28796527, 29777230, 31688081		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	23609427	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	28643476		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	17989154, 25601511, 27621224, 28117613, 28639107, 28796527, 28982776, 29174427, 29675134, 29867728, 30032465, 30127766, 30524367, 30903184, 31055727, 31087350, 31210052, 31253409, 31372721, 31383242, 31570053, 31688081		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	18365276		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	16944669		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30285278, 30309268, 31383242		★☆☆☆☆ Found in Text Mining only
Slipped Capital Femoral Epiphyses	Slipped Capital Femoral Epiphyses	BEFREE	28509827		★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	10594516, 21207066, 22350661, 23009903, 26915772, 28596789		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	10661913		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	29909551		★☆☆☆☆ Found in Text Mining only
Spinal stenosis of lumbar region	Spinal Stenosis Of Lumbar Region	BEFREE	29436483		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	16803678, 28190851		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25809704, 28459203, 29158066, 29254802		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29312594		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25809704, 26015646	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29287786		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	11095344, 14642624, 17032406, 17652166, 20573726, 21151569, 22171144, 22215535, 22530350, 22768838, 22981538, 23024365, 23651953, 25415231, 28086768, 28281237, 28358008, 28710554, 29089335, 29129025, 29507217, 29575696, 29660503, 30052309, 30424542, 30664851, 30870482, 31071311, 31167890, 31222048, 31708526, 31842467		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	12661780, 19716478, 23839791, 24525044, 25554529, 27712037		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17006991, 17590101, 23178499, 23354307, 24548863, 28316984, 30078770, 30449153, 31444698		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	17006991	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16437696, 17006991, 24569475, 26147886, 28316984, 35866593	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17006991, 18595130		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24548863	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19473179	Associate	★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	30021121		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	22265003		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27321124, 31333350		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30333864		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	31595672		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	26701291		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	30321519		★☆☆☆☆ Found in Text Mining only
Testicular hypogonadism	Testicular Hypogonadism	BEFREE	29948931		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	34299256	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	15869602	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	15869602	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	15291748, 15886250		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33587254	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20428831, 27050378		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	37432370	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20428831, 27050378, 30657911		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33587254	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	28791847		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	30657911	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	17587397		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28439190, 29410303		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28414093, 28729467, 29453319, 31118047		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32471192, 37489486	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15012781		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23211301, 29033577, 31702041		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29870819, 30071417, 30554862, 30562581, 30878306, 31230885, 31465895		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	LHGDN	14681862		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	15931394		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	23058473, 9186891	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32363657, 34229569, 37892180	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	16273205, 28010141		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28118269		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29568885, 30633613		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	34093426	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	14629465, 23856194, 25448795, 26278057, 35837388	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	18670142		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31656096		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	20016047	Inhibit	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	29548819		★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34309635	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	17425664	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	29229519		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	29907861	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31533725	Stimulate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	17993459		★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	17191030		★☆☆☆☆ Found in Text Mining only