Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57146
Gene name	Lipid droplet assembly factor 1
Gene symbol	LDAF1
Synonyms (NCBI Gene)	TMEM159
Chromosome	16
Chromosome location	16p12.3

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 25910212, 26871637, 30901948, 31708432, 32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	30901948, 31708432
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005811	Component	Lipid droplet	IDA	30901948, 31708432
GO:0005811	Component	Lipid droplet	IEA
GO:0016020	Component	Membrane	IEA
GO:0140042	Process	Lipid droplet formation	IMP	31708432

MIM	HGNC	e!Ensembl
611304	30136	ENSG00000011638

Q96B96

Protein name

Lipid droplet assembly factor 1 (Promethin) (Transmembrane protein 159)

Protein function

Plays an important role in the formation of lipid droplets (LD) which are storage organelles at the center of lipid and energy homeostasis (PubMed:31708432). In association with BSCL2/seipin, defines the sites of LD formation in the endoplasmic

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16015	Promethin	18 → 128		Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the heart and skeletal muscle. Expressed at low levels in kidney, small intestine, lung and liver. {ECO:0000269|PubMed:15589683}.

Sequence

MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVAFMKSPVGQYLDSHPFLAFTLLVFIV
MSAVPVGFFLLIVVLTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGMMIAS
YVVVSSLISCWFSPRPLTQQNTSCDFLPAMKSAEFEGLYQE

Sequence length

161

Interactions

View interactions

Related Genes Genes most often co-reported with LDAF1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for LDAF1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to LDAF1 (see Related Genes above), that are NOT already directly curated for LDAF1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to LDAF1.

LDAF1 (lipid droplet assembly factor 1)

Save This Analysis