LCNL1 (lipocalin like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401562
Gene name Lipocalin like 1
Gene symbol LCNL1
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018070 hsa-miR-335-5p Microarray 18185580
MIRT1105787 hsa-miR-127-3p CLIP-seq
MIRT1922823 hsa-miR-1249 CLIP-seq
MIRT1922824 hsa-miR-1912 CLIP-seq
MIRT1922825 hsa-miR-4290 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0036094 Function Small molecule binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZST4
Protein name Lipocalin-like 1 protein
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 1 → 110 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MVGVVSDDQDFLDSKDTMKMAVVLVTPLGNGDLALKFGYPTPHGGCQKMDTTFTEGAVPG
QFSNPAMALSDIRVAFSDYQHFALLYLEMRKGGLRNQWLQLYGGRAAGRRPRHPRFGSGM
SPLCLHQPFLHAEGGTAGSWCLWPRVPAPPCPSLPLFAPPAPSL
Sequence length 164
Interactions View interactions

No strongly related genes found yet for LCNL1.

No additional diseases found yet through genes similar to LCNL1.