LCN8 (lipocalin 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 138307
Gene name Lipocalin 8
Gene symbol LCN8
Synonyms (NCBI Gene)
EP17LCN5
Chromosome 9
Chromosome location 9q34.3
Summary Members of the lipocalin family, such as LCN8, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to s
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2029210 hsa-miR-1207-5p CLIP-seq
MIRT2029211 hsa-miR-125a-3p CLIP-seq
MIRT2029212 hsa-miR-3661 CLIP-seq
MIRT2029213 hsa-miR-3665 CLIP-seq
MIRT2029214 hsa-miR-4763-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0009725 Process Response to hormone IEA
GO:0036094 Function Small molecule binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612902 27038 ENSG00000204001
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6JVE9
Protein name Epididymal-specific lipocalin-8
Protein function May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 33 → 158 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MPGAAEALPTVTVTLVAGAVPPASGALTAHCIGGFWREVGVASDQSLVLTAPKRVEGLFL
TLSGSNLTVKVAYNSSGSCEIEKIVGSEIDSTGKFAFPGHREIHVLDTDYEGYAILRVSL
MWRGRNFRVLKYFTRSLEDKDRLGFWKFRELTADTGLYLAARPGRCAELLKEELI
Sequence length 175
Interactions View interactions

No strongly related genes found yet for LCN8.

No additional diseases found yet through genes similar to LCN8.