LCN1P1 (lipocalin 1 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 286310
Gene name Lipocalin 1 pseudogene 1
Gene symbol LCN1P1
Synonyms (NCBI Gene)
LCN1L1bA430N14.2
Chromosome 9
Chromosome location 9q34.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space HDA 22664934, 23580065
GO:0005615 Component Extracellular space IBA
GO:0036094 Function Small molecule binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VSP4
Protein name Putative lipocalin 1-like protein 1 (Lipocalin 1-like pseudogene 1)
Protein function May bind a variety of ligands including lipids.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 32 → 155 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MKPLLLAISLSLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDRELPEMNLESVTPMTLT
ILEGGNLEAKATMLISGQCQEVKVILEKTDEPGKYTANRGKHVAYIIRSHMKDHYIFYCE
GRDPENNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
Sequence length 162
Interactions View interactions

No strongly related genes found yet for LCN1P1.

No additional diseases found yet through genes similar to LCN1P1.