LCN15 (lipocalin 15)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 389812
Gene name Lipocalin 15
Gene symbol LCN15
Synonyms (NCBI Gene)
PRO6093UNQ2541
Chromosome 9
Chromosome location 9q34.3
miRNA miRNA information provided by mirtarbase database.
11 Show/Hide all (11)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2260165 hsa-miR-185 CLIP-seq
MIRT2260166 hsa-miR-1908 CLIP-seq
MIRT2260167 hsa-miR-2392 CLIP-seq
MIRT2260168 hsa-miR-3605-5p CLIP-seq
MIRT2260169 hsa-miR-4306 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 36217029
GO:0005576 Component Extracellular region IEA
GO:0036094 Function Small molecule binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWW0
Protein name Lipocalin-15
PDB 2XST
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 34 → 174 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMST
RAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFA
VLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPES
KEAP
Sequence length 184
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Transport of fatty acids
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
STROKE — GWAS catalog 38317187
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for LCN15.

No additional diseases found yet through genes similar to LCN15.