LCN10 (lipocalin 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 414332
• Gene name: Lipocalin 10
• Gene symbol: LCN10
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: Members of the lipocalin family, such as LCN10, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712810	hsa-miR-5007-5p	HITS-CLIP	19536157
MIRT712809	hsa-miR-192-5p	HITS-CLIP	19536157
MIRT712808	hsa-miR-215-5p	HITS-CLIP	19536157
MIRT712810	hsa-miR-5007-5p	HITS-CLIP	19536157
MIRT712809	hsa-miR-192-5p	HITS-CLIP	19536157
MIRT712808	hsa-miR-215-5p	HITS-CLIP	19536157
MIRT1105755	hsa-miR-124	CLIP-seq
MIRT1105756	hsa-miR-192	CLIP-seq
MIRT1105757	hsa-miR-215	CLIP-seq
MIRT1105758	hsa-miR-2467-3p	CLIP-seq
MIRT1105759	hsa-miR-3131	CLIP-seq
MIRT1105760	hsa-miR-3169	CLIP-seq
MIRT1105761	hsa-miR-3616-3p	CLIP-seq
MIRT1105762	hsa-miR-3960	CLIP-seq
MIRT1105763	hsa-miR-4267	CLIP-seq
MIRT1105764	hsa-miR-4285	CLIP-seq
MIRT1105765	hsa-miR-4436b-3p	CLIP-seq
MIRT1105766	hsa-miR-4467	CLIP-seq
MIRT1105767	hsa-miR-4663	CLIP-seq
MIRT1105768	hsa-miR-4708-3p	CLIP-seq
MIRT1105769	hsa-miR-506	CLIP-seq
MIRT1105770	hsa-miR-611	CLIP-seq
MIRT1105756	hsa-miR-192	CLIP-seq
MIRT1105757	hsa-miR-215	CLIP-seq
MIRT1105756	hsa-miR-192	CLIP-seq
MIRT1105757	hsa-miR-215	CLIP-seq
MIRT2029204	hsa-miR-224	CLIP-seq
MIRT2029205	hsa-miR-4793-5p	CLIP-seq
MIRT1105756	hsa-miR-192	CLIP-seq
MIRT1105757	hsa-miR-215	CLIP-seq
MIRT2029204	hsa-miR-224	CLIP-seq
MIRT2260160	hsa-miR-2964a-5p	CLIP-seq
MIRT2260161	hsa-miR-377	CLIP-seq
MIRT2260162	hsa-miR-3942-3p	CLIP-seq
MIRT2029205	hsa-miR-4793-5p	CLIP-seq
MIRT2260163	hsa-miR-5096	CLIP-seq
MIRT2260164	hsa-miR-511	CLIP-seq
MIRT1105756	hsa-miR-192	CLIP-seq
MIRT1105757	hsa-miR-215	CLIP-seq
MIRT2452873	hsa-miR-1269	CLIP-seq
MIRT2452874	hsa-miR-1269b	CLIP-seq
MIRT2452875	hsa-miR-1288	CLIP-seq
MIRT2452876	hsa-miR-136	CLIP-seq
MIRT2452877	hsa-miR-4515	CLIP-seq
MIRT2452878	hsa-miR-4740-5p	CLIP-seq
MIRT2452879	hsa-miR-515-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007507	Process	Heart development	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034341	Process	Response to type II interferon	IEA
GO:0036094	Function	Small molecule binding	IEA
GO:0042116	Process	Macrophage activation	IEA

Other IDs

• MIM: 612904
• HGNC: 20892
• e!Ensembl: ENSG00000187922

Protein

• UniProt ID: Q6JVE6
• Protein name: Epididymal-specific lipocalin-10
• Protein function: May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.
• Sequence:

  MRQGLLVLALVLVLVLVLAAGSQVQEWYPRESHALNWNKFSGFWYILATATDAQGFLPAR
  DKRKLGASVVKVNKVGQLRVLLAFRRGQGCGRAQPRHPGTSGHLWASLSVKGVKAFHVLS
  TDYSYGLVYLRLGRATQNYKNLLLFHRQNVSSFQSLKEFMDACDILGLSKAAVILPKDAS
  RTHTILP

• Sequence length: 187

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Heart Failure	Heart failure	Pubtator	25725476	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for LCN10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LCN10.