LCE2D (late cornified envelope 2D)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 353141
• Gene name: Late cornified envelope 2D
• Gene symbol: LCE2D
• Synonyms (NCBI Gene): LEP12, SPRL1A
• Chromosome: 1
• Chromosome location: 1q21.3

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2029126	hsa-miR-2110	CLIP-seq
MIRT2029127	hsa-miR-3189-5p	CLIP-seq
MIRT2029128	hsa-miR-4271	CLIP-seq
MIRT2029129	hsa-miR-4314	CLIP-seq
MIRT2029130	hsa-miR-4323	CLIP-seq
MIRT2029131	hsa-miR-4667-5p	CLIP-seq
MIRT2029132	hsa-miR-4700-5p	CLIP-seq
MIRT2029133	hsa-miR-4725-3p	CLIP-seq
MIRT2029134	hsa-miR-637	CLIP-seq
MIRT2029135	hsa-miR-671-5p	CLIP-seq
MIRT2260108	hsa-miR-591	CLIP-seq
MIRT2260109	hsa-miR-657	CLIP-seq
MIRT2029126	hsa-miR-2110	CLIP-seq
MIRT2029127	hsa-miR-3189-5p	CLIP-seq
MIRT2029128	hsa-miR-4271	CLIP-seq
MIRT2029129	hsa-miR-4314	CLIP-seq
MIRT2029130	hsa-miR-4323	CLIP-seq
MIRT2029131	hsa-miR-4667-5p	CLIP-seq
MIRT2029132	hsa-miR-4700-5p	CLIP-seq
MIRT2029133	hsa-miR-4725-3p	CLIP-seq
MIRT2029134	hsa-miR-637	CLIP-seq
MIRT2029135	hsa-miR-671-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0008544	Process	Epidermis development	IEA
GO:0031424	Process	Keratinization	IEA

Other IDs

• MIM: 612612
• HGNC: 16518
• e!Ensembl: ENSG00000187223

Protein

• UniProt ID: Q5TA82
• Protein name: Late cornified envelope protein 2D (Late envelope protein 12) (Small proline-rich-like epidermal differentiation complex protein 1A)
• Protein function: Precursors of the cornified envelope of the stratum corneum.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14672	LCE	53 → 110	Late cornified envelope	Family

• Tissue specificity: TISSUE SPECIFICITY: Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}.
• Sequence:

  MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSS
  GGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC

• Sequence length: 110

Pathways

Reactome Pathway:

Formation of the cornified envelope

Related Genes

No strongly related genes found yet for LCE2D.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to LCE2D.