LCE1B (late cornified envelope 1B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 353132
Gene name Late cornified envelope 1B
Gene symbol LCE1B
Synonyms (NCBI Gene)
LEP2SPRL2A
Chromosome 1
Chromosome location 1q21.3
miRNA miRNA information provided by mirtarbase database.
24 Show/Hide all (24)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT560591 hsa-miR-4428 PAR-CLIP 20371350
MIRT560590 hsa-miR-5584-5p PAR-CLIP 20371350
MIRT560589 hsa-miR-6125 PAR-CLIP 20371350
MIRT560588 hsa-miR-1252-5p PAR-CLIP 20371350
MIRT560587 hsa-miR-7515 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 29892012, 31515488, 32296183, 32814053, 36804407
GO:0008544 Process Epidermis development IEA
GO:0031424 Process Keratinization IEA
GO:0042802 Function Identical protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612604 16611 ENSG00000196734
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T7P3
Protein name Late cornified envelope protein 1B (Late envelope protein 2) (Small proline-rich-like epidermal differentiation complex protein 2A)
Protein function Precursors of the cornified envelope of the stratum corneum.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14672 LCE 58 → 118 Late cornified envelope Family
PF14672 LCE 27 → 60 Late cornified envelope Family
Tissue specificity TISSUE SPECIFICITY: Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049}.
Sequence 
MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC
GSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC
Sequence length 118
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Formation of the cornified envelope

No strongly related genes found yet for LCE1B.

No additional diseases found yet through genes similar to LCE1B.