LBHD2 (LBH domain containing 2)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 107984640 |
| Gene name | LBH domain containing 2 |
| Gene symbol | LBHD2 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 14 |
| Chromosome location | 14q32.32 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A0U1RRK4 | ||||||||||
| Protein name | LBH domain-containing protein 2 | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWP |
||||||||||
| Sequence length | 108 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with LBHD2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to LBHD2 (see Related Genes above), that are NOT already directly curated for LBHD2 itself -- a lead worth checking, not a confirmed association.
0
|
|