Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	3910
Gene name	Laminin subunit alpha 4
Gene symbol	LAMA4
Synonyms (NCBI Gene)	CMD1JJLAMA3LAMA4*-1
Chromosome	6
Chromosome location	6q21
Summary	Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, n

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs3752579	A>T	Conflicting-interpretations-of-pathogenicity, benign	Genic downstream transcript variant, coding sequence variant, non coding transcript variant, missense variant
rs145897390	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, coding sequence variant, non coding transcript variant, missense variant
rs150084275	G>A,C	Likely-benign, conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, coding sequence variant, non coding transcript variant, missense variant
rs200112094	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs201209516	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant, genic downstream transcript variant
rs371906362	C>A,G,T	Conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, intron variant
rs782010849	C>T	Conflicting-interpretations-of-pathogenicity	Non coding transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs863223690	C>T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022144	hsa-miR-124-3p	Microarray	18668037
MIRT038757	hsa-miR-93-3p	CLASH	23622248
MIRT462261	hsa-miR-4274	PAR-CLIP	23592263
MIRT462260	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT462259	hsa-miR-7705	PAR-CLIP	23592263
MIRT462258	hsa-miR-922	PAR-CLIP	23592263
MIRT462257	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT462256	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT462255	hsa-miR-761	PAR-CLIP	23592263
MIRT462254	hsa-miR-103b	PAR-CLIP	23592263
MIRT462253	hsa-miR-3665	PAR-CLIP	23592263
MIRT462252	hsa-miR-657	PAR-CLIP	23592263
MIRT462251	hsa-miR-4291	PAR-CLIP	23592263
MIRT462261	hsa-miR-4274	PAR-CLIP	23592263
MIRT462260	hsa-miR-6854-5p	PAR-CLIP	23592263
MIRT462259	hsa-miR-7705	PAR-CLIP	23592263
MIRT462258	hsa-miR-922	PAR-CLIP	23592263
MIRT462257	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT462256	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT462255	hsa-miR-761	PAR-CLIP	23592263
MIRT462254	hsa-miR-103b	PAR-CLIP	23592263
MIRT462253	hsa-miR-3665	PAR-CLIP	23592263
MIRT462252	hsa-miR-657	PAR-CLIP	23592263
MIRT462251	hsa-miR-4291	PAR-CLIP	23592263
MIRT1103250	hsa-miR-3183	CLIP-seq
MIRT1103251	hsa-miR-4723-3p	CLIP-seq
MIRT1103252	hsa-miR-590-3p	CLIP-seq
MIRT1103253	hsa-miR-1273f	CLIP-seq
MIRT1103254	hsa-miR-1297	CLIP-seq
MIRT1103255	hsa-miR-2467-3p	CLIP-seq
MIRT1103256	hsa-miR-26a	CLIP-seq
MIRT1103257	hsa-miR-26b	CLIP-seq
MIRT1103258	hsa-miR-3678-3p	CLIP-seq
MIRT1103259	hsa-miR-4272	CLIP-seq
MIRT1103260	hsa-miR-4465	CLIP-seq
MIRT1103261	hsa-miR-450b-3p	CLIP-seq
MIRT1103262	hsa-miR-4528	CLIP-seq
MIRT1103263	hsa-miR-4695-3p	CLIP-seq
MIRT1103264	hsa-miR-4713-3p	CLIP-seq
MIRT1103265	hsa-miR-4756-3p	CLIP-seq
MIRT1103266	hsa-miR-634	CLIP-seq
MIRT1103267	hsa-miR-638	CLIP-seq
MIRT1103268	hsa-miR-769-3p	CLIP-seq
MIRT1103262	hsa-miR-4528	CLIP-seq
MIRT2028226	hsa-miR-122	CLIP-seq
MIRT2028227	hsa-miR-3135b	CLIP-seq
MIRT2028228	hsa-miR-3652	CLIP-seq
MIRT2028229	hsa-miR-4423-5p	CLIP-seq
MIRT2028230	hsa-miR-4430	CLIP-seq
MIRT2442319	hsa-miR-3166	CLIP-seq
MIRT1103258	hsa-miR-3678-3p	CLIP-seq
MIRT2442320	hsa-miR-4771	CLIP-seq
MIRT2028226	hsa-miR-122	CLIP-seq
MIRT2452853	hsa-miR-1267	CLIP-seq
MIRT2028227	hsa-miR-3135b	CLIP-seq
MIRT2028228	hsa-miR-3652	CLIP-seq
MIRT2452854	hsa-miR-3664-5p	CLIP-seq
MIRT2028229	hsa-miR-4423-5p	CLIP-seq
MIRT2028230	hsa-miR-4430	CLIP-seq
MIRT2452855	hsa-miR-4639-3p	CLIP-seq
MIRT1103263	hsa-miR-4695-3p	CLIP-seq
MIRT2559722	hsa-miR-1184	CLIP-seq
MIRT2028226	hsa-miR-122	CLIP-seq
MIRT2559723	hsa-miR-1226	CLIP-seq
MIRT2452853	hsa-miR-1267	CLIP-seq
MIRT2559724	hsa-miR-197	CLIP-seq
MIRT2559725	hsa-miR-205	CLIP-seq
MIRT2559726	hsa-miR-214	CLIP-seq
MIRT2559727	hsa-miR-2964a-3p	CLIP-seq
MIRT2559728	hsa-miR-300	CLIP-seq
MIRT2028227	hsa-miR-3135b	CLIP-seq
MIRT2442319	hsa-miR-3166	CLIP-seq
MIRT2028228	hsa-miR-3652	CLIP-seq
MIRT2452854	hsa-miR-3664-5p	CLIP-seq
MIRT1103258	hsa-miR-3678-3p	CLIP-seq
MIRT2559729	hsa-miR-381	CLIP-seq
MIRT2559730	hsa-miR-4252	CLIP-seq
MIRT2559731	hsa-miR-4418	CLIP-seq
MIRT2028229	hsa-miR-4423-5p	CLIP-seq
MIRT2028230	hsa-miR-4430	CLIP-seq
MIRT2452855	hsa-miR-4639-3p	CLIP-seq
MIRT1103263	hsa-miR-4695-3p	CLIP-seq
MIRT2559732	hsa-miR-4733-3p	CLIP-seq
MIRT2442320	hsa-miR-4771	CLIP-seq
MIRT2559733	hsa-miR-483-3p	CLIP-seq
MIRT2559734	hsa-miR-509-3-5p	CLIP-seq
MIRT2559735	hsa-miR-509-5p	CLIP-seq
MIRT2559736	hsa-miR-5096	CLIP-seq
MIRT2559722	hsa-miR-1184	CLIP-seq
MIRT2028226	hsa-miR-122	CLIP-seq
MIRT2559723	hsa-miR-1226	CLIP-seq
MIRT2452853	hsa-miR-1267	CLIP-seq
MIRT2559724	hsa-miR-197	CLIP-seq
MIRT2559725	hsa-miR-205	CLIP-seq
MIRT2559726	hsa-miR-214	CLIP-seq
MIRT2559727	hsa-miR-2964a-3p	CLIP-seq
MIRT2559728	hsa-miR-300	CLIP-seq
MIRT2028227	hsa-miR-3135b	CLIP-seq
MIRT2442319	hsa-miR-3166	CLIP-seq
MIRT2683722	hsa-miR-3545-3p	CLIP-seq
MIRT2028228	hsa-miR-3652	CLIP-seq
MIRT2452854	hsa-miR-3664-5p	CLIP-seq
MIRT1103258	hsa-miR-3678-3p	CLIP-seq
MIRT2559729	hsa-miR-381	CLIP-seq
MIRT2559730	hsa-miR-4252	CLIP-seq
MIRT2559731	hsa-miR-4418	CLIP-seq
MIRT2028229	hsa-miR-4423-5p	CLIP-seq
MIRT2028230	hsa-miR-4430	CLIP-seq
MIRT2452855	hsa-miR-4639-3p	CLIP-seq
MIRT1103263	hsa-miR-4695-3p	CLIP-seq
MIRT2559732	hsa-miR-4733-3p	CLIP-seq
MIRT2442320	hsa-miR-4771	CLIP-seq
MIRT2559733	hsa-miR-483-3p	CLIP-seq
MIRT2559734	hsa-miR-509-3-5p	CLIP-seq
MIRT2559735	hsa-miR-509-5p	CLIP-seq
MIRT2559736	hsa-miR-5096	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005201	Function	Extracellular matrix structural constituent	ISS
GO:0005201	Function	Extracellular matrix structural constituent	RCA	25037231, 27068509, 27559042, 28675934
GO:0005201	Function	Extracellular matrix structural constituent	TAS	7959779
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IDA	14557481
GO:0005604	Component	Basement membrane	IEA
GO:0005604	Component	Basement membrane	TAS	7959779
GO:0007155	Process	Cell adhesion	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27068509, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 21362503
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	28973559

MIM	HGNC	e!Ensembl
600133	6484	ENSG00000112769

Q16363

Protein name

Laminin subunit alpha-4 (Laminin-14 subunit alpha) (Laminin-8 subunit alpha) (Laminin-9 subunit alpha)

Protein function

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00053	Laminin_EGF	82 → 129	Laminin EGF domain	Domain
PF00053	Laminin_EGF	132 → 184	Laminin EGF domain	Domain
PF00053	Laminin_EGF	187 → 241	Laminin EGF domain	Domain
PF06008	Laminin_I	298 → 555	Laminin Domain I	Coiled-coil
PF06009	Laminin_II	734 → 861	Laminin Domain II	Coiled-coil
PF02210	Laminin_G_2	874 → 1014	Laminin G domain	Domain
PF02210	Laminin_G_2	1079 → 1210	Laminin G domain	Domain
PF02210	Laminin_G_2	1263 → 1379	Laminin G domain	Domain
PF02210	Laminin_G_2	1499 → 1626	Laminin G domain	Domain
PF02210	Laminin_G_2	1676 → 1801	Laminin G domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in placenta (at protein level) (PubMed:32337544). Detected in fibroblasts and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). In adult, strong expression in heart, lung, ovary small and large inte

Sequence

MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDALRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA

Sequence length

1823

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (43)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Arrhythmogenic right ventricular cardiomyopathy	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARRHYTHMOGENIC RIGHT VENTRICULAR DYSPLASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brugada syndrome	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada syndrome 9	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CARDIOMYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1JJ	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular phenotype	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Catecholaminergic polymorphic ventricular tachycardia 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dilated cardiomyopathy 1JJ	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dilated cardiomyopathy 1S	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dilated cardiomyopathy 3B	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DMD-ASSOCIATED DILATED CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial atrial fibrillation	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ISOLATED DILATED CARDIOMYOPATHY	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL OR IDIOPATHIC DILATED CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic cardiomyopathy	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic cardiomyopathy 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LAMA4-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left ventricular noncompaction cardiomyopathy	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ventricular contraction	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary dilated cardiomyopathy	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary familial hypertrophic cardiomyopathy	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPINOCEREBELLAR ATAXIA 19	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spinocerebellar ataxia type 19/22	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular tachycardia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR TACHYCARDIA, CATECHOLAMINERGIC POLYMORPHIC, 1, WITH OR WITHOUT ATRIAL DYSFUNCTION AND/OR DILATED CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wolff-Parkinson-White pattern	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WOLFF-PARKINSON-WHITE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (155)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	11891209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23301059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31557618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23301059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult junctional epidermolysis bullosa (disorder)	Junctional Epidermolysis Bullosa	GENOMICS_ENGLAND_DG	27827380, 8530087, 8618022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult junctional epidermolysis bullosa (disorder)	Junctional Epidermolysis Bullosa	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult junctional epidermolysis bullosa (disorder)	Junctional Epidermolysis Bullosa	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27903086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	25085501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	Pubtator	31478359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis Imperfecta	Amelogenesis imperfecta	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta local hypoplastic form	Amelogenesis Imperfecta	GENOMICS_ENGLAND_DG	27827380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	22959728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	22959728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankyloglossia	Ankyloglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28813618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANONYCHIA	Anonychia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31182680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	35526016	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11854734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28767591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31553662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34456632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	34796550, 8618020, 8618058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	23199169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	16146715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34541602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23301059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25866923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12079511, 33327879, 37051625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31182680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31723229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	8370973	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31402958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35893073	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30650640, 31024045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1JJ	Cardiomyopathy	UNIPROT_DG	17646580		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1JJ	Cardiomyopathy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1JJ	Cardiomyopathy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract	Cataract	BEFREE	21700104, 24312600, 26053017, 27903086, 28182590, 28831699, 29117413, 29600173, 30260193, 30392762, 30489359, 30721686, 31654499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31076560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	17143621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	38114514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20372818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16249459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25257191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29504916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital localized absence of skin	Congenital localized absence of skin	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28599476, 31130475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30395682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental enamel hypoplasia	Pubtator	27827380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental Enamel Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27729280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	25363238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	9205497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia unguium	Nail dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37612452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis Bullosa	BEFREE	10367729, 22963541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	33921969, 36578049, 38429928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Junctional	Junctional epidermolysis bullosa	Pubtator	10469327, 11564184, 23958762, 25363238, 27827380, 29946029, 32222156, 35234826, 38157931, 8228337, 8618020, 8618022, 8618058, 9326326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Progressiva	Epidermolysis Bullosa	CTD_human_DG	12915477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Pruriginosa	Dystrophic epidermolysis bullosa	Pubtator	36578049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EPIDERMOLYSIS BULLOSA, JUNCTIONAL, LOCALISATA VARIANT (disorder)	Epidermolysis Bullosa	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	40234833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36290884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial dilated cardiomyopathy	Cardiomyopathy	ORPHANET_DG	17646580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial isolated dilated cardiomyopathy	Dilated Cardiomyopathy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	28726551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30874465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17825249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15915502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29846705	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	9060828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	19936049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35526016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Herlitz Disease	Junctional epidermolysis bullosa gravis of Herlitz	CLINVAR_DG	11810295, 12813757, 12943669, 15373767, 16473856, 16971478, 17362460, 22434185, 25525159, 27375110, 27827380, 7633458, 8530087, 8618022, 8983017, 9160387 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Herlitz Disease	Junctional epidermolysis bullosa gravis of Herlitz	CTD_human_DG	12915477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Herlitz Disease	Junctional epidermolysis bullosa gravis of Herlitz	BEFREE	1499575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Herlitz Disease	Junctional epidermolysis bullosa gravis of Herlitz	GENOMICS_ENGLAND_DG	27827380, 8530087, 8618022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19936049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29920840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27729280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intermediate generalized junctional epidermolysis bullosa	Junctional Epidermolysis Bullosa	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	BEFREE	12915477, 12943669, 1499575, 20881434, 21357940, 21693480, 22963541, 24390279, 25950805, 27827380, 28087116, 28561256, 7633458, 8530087, 8586427, 8618022, 9085255, 9579554 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	CTD_human_DG	12915477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	LHGDN	12943669, 15373767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Junctional Epidermolysis Bullosa	Junctional Epidermolysis Bullosa	GENOMICS_ENGLAND_DG	8530087, 8618022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Junctional split	Junctional split	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngo-onycho-cutaneous syndrome	Laryngoonychocutaneous Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngoonychocutaneous syndrome	Laryngoonychocutaneous Syndrome	CTD_human_DG	12915477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngoonychocutaneous syndrome	Laryngoonychocutaneous Syndrome	ORPHANET_DG	12915477, 23869449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngoonychocutaneous syndrome	Laryngoonychocutaneous Syndrome	BEFREE	17362460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngoonychocutaneous syndrome	Laryngoonychocutaneous Syndrome	GENOMICS_ENGLAND_DG	27827380, 8530087, 8618022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngoonychocutaneous syndrome	Laryngoonychocutaneous Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngostenosis	Laryngostenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18084776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	12079511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26683690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14695139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31402958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14695140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30015861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11775027, 14695139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14695139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22032772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30134924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20036365, 20372818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail Diseases	Nail Diseases	CTD_human_DG	12915477		★★★★★ ★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14695139, 14973053, 17143621, 18084776, 24681327, 25866923, 29180478, 30015861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Onycholysis	Onycholysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33308057, 36539799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	28346442		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31402958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32878513, 33992120, 34289901, 34512203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	GWASCAT_DG	28346442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34134622, 34732125, 36311789, 37198621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paronychia Inflammation	Paronychia Inflammation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	30721686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	25149502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38429928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyloric Atresia	Pyloric Atresia	BEFREE	1499575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31130475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28767591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26055407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe generalized junctional epidermolysis bullosa	Junctional Epidermolysis Bullosa	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24675808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24675808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30015861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34414238, 8780383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	35526016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29434522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37694778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van der woude syndrome	Pubtator	27827380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LAMA4 (laminin subunit alpha 4)