KXD1 (KxDL motif containing 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79036
• Gene name: KxDL motif containing 1
• Gene symbol: KXD1
• Synonyms (NCBI Gene): BORCS4, C10orf50, C19orf50, KXDL, MST096, MSTP096
• Chromosome: 19
• Chromosome location: 19p13.11

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052214	hsa-let-7b-5p	CLASH	23622248
MIRT047547	hsa-miR-10a-5p	CLASH	23622248
MIRT044005	hsa-miR-378a-5p	CLASH	23622248
MIRT041537	hsa-miR-193b-3p	CLASH	23622248
MIRT037964	hsa-miR-505-5p	CLASH	23622248
MIRT525668	hsa-miR-3940-3p	PAR-CLIP	22012620
MIRT525667	hsa-miR-6807-5p	PAR-CLIP	22012620
MIRT525668	hsa-miR-3940-3p	PAR-CLIP	22012620
MIRT525667	hsa-miR-6807-5p	PAR-CLIP	22012620

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 25898167, 25910212, 28514442, 31413325, 31515488, 32296183, 33961781
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	ISS
GO:0031083	Component	BLOC-1 complex	ISS
GO:0032418	Process	Lysosome localization	IBA
GO:0032418	Process	Lysosome localization	IMP	25898167
GO:0032418	Process	Lysosome localization	NAS	25898167
GO:0051036	Process	Regulation of endosome size	NAS	31314175
GO:0062196	Process	Regulation of lysosome size	NAS	31314175
GO:0072384	Process	Organelle transport along microtubule	NAS	25898167
GO:0098574	Component	Cytoplasmic side of lysosomal membrane	NAS	25898167
GO:0099078	Component	BORC complex	IBA
GO:0099078	Component	BORC complex	IDA	25898167
GO:0099078	Component	BORC complex	IPI	25898167

Other IDs

• MIM: 615178
• HGNC: 28420
• e!Ensembl: ENSG00000105700

Protein

• UniProt ID: Q9BQD3
• Protein name: KxDL motif-containing protein 1
• Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed k
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10241	KxDL	14 → 99	Uncharacterized conserved protein	Domain

• Sequence:

  MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMS
  ERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPST
  TTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE

• Sequence length: 176

Related Genes

No strongly related genes found yet for KXD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KXD1.