KRTAP9-9 (keratin associated protein 9-9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 81870
Gene name Keratin associated protein 9-9
Gene symbol KRTAP9-9
Synonyms (NCBI Gene)
KAP9.5KAP9.9KRTAP9-5KRTAP9.9
Chromosome 17
Chromosome location 17q21.2
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an
miRNA miRNA information provided by mirtarbase database.
7 Show/Hide all (7)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2027852 hsa-miR-4699-5p CLIP-seq
MIRT2259115 hsa-miR-103a CLIP-seq
MIRT2259116 hsa-miR-107 CLIP-seq
MIRT2259117 hsa-miR-1301 CLIP-seq
MIRT2027852 hsa-miR-4699-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0045095 Component Keratin filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYP9
Protein name Keratin-associated protein 9-9 (Keratin-associated protein 9-5) (Keratin-associated protein 9.5) (Keratin-associated protein 9.9) (Ultrahigh sulfur keratin-associated protein 9.9)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 61 → 104 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 28 → 74 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 124 → 154 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 102 → 144 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 1 → 37 Keratin, high sulfur B2 protein Family
Sequence 
MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPACCQNT
CCRTTCCQPTCLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSC
CQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC
Sequence length 154
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP9-9.

No additional diseases found yet through genes similar to KRTAP9-9.