KRTAP9-3 (keratin associated protein 9-3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 83900
• Gene name: Keratin associated protein 9-3
• Gene symbol: KRTAP9-3
• Synonyms (NCBI Gene): KAP9.3, KRTAP9.3
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an

miRNA Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2259089	hsa-miR-15a	CLIP-seq
MIRT2259090	hsa-miR-15b	CLIP-seq
MIRT2259091	hsa-miR-16	CLIP-seq
MIRT2259092	hsa-miR-195	CLIP-seq
MIRT2259093	hsa-miR-214	CLIP-seq
MIRT2259094	hsa-miR-3619-5p	CLIP-seq
MIRT2259095	hsa-miR-3973	CLIP-seq
MIRT2259096	hsa-miR-424	CLIP-seq
MIRT2259097	hsa-miR-4291	CLIP-seq
MIRT2259098	hsa-miR-4687-3p	CLIP-seq
MIRT2259099	hsa-miR-497	CLIP-seq
MIRT2259100	hsa-miR-545	CLIP-seq
MIRT2259101	hsa-miR-548a-5p	CLIP-seq
MIRT2259102	hsa-miR-548ab	CLIP-seq
MIRT2259103	hsa-miR-548ak	CLIP-seq
MIRT2259104	hsa-miR-548b-5p	CLIP-seq
MIRT2259105	hsa-miR-548c-5p	CLIP-seq
MIRT2259106	hsa-miR-548d-5p	CLIP-seq
MIRT2259107	hsa-miR-548h	CLIP-seq
MIRT2259108	hsa-miR-548i	CLIP-seq
MIRT2259109	hsa-miR-548j	CLIP-seq
MIRT2259110	hsa-miR-548w	CLIP-seq
MIRT2259111	hsa-miR-548y	CLIP-seq
MIRT2259112	hsa-miR-559	CLIP-seq
MIRT2259113	hsa-miR-761	CLIP-seq
MIRT2259114	hsa-miR-922	CLIP-seq
MIRT2452803	hsa-miR-127-5p	CLIP-seq
MIRT2452804	hsa-miR-186	CLIP-seq
MIRT2452805	hsa-miR-216b	CLIP-seq
MIRT2452803	hsa-miR-127-5p	CLIP-seq
MIRT2452804	hsa-miR-186	CLIP-seq
MIRT2452805	hsa-miR-216b	CLIP-seq
MIRT2452805	hsa-miR-216b	CLIP-seq
MIRT2452805	hsa-miR-216b	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045095	Component	Keratin filament	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BYQ3
• Protein name: Keratin-associated protein 9-3 (Keratin-associated protein 9.3) (Ultrahigh sulfur keratin-associated protein 9.3)
• Protein function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13885	Keratin_B2_2	65 → 109	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	23 → 69	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	129 → 159	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	2 → 46	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	109 → 150	Keratin, high sulfur B2 protein	Family

• Sequence:

  MTHCCSPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTT
  CCQPICVTSCCQPSCCSTPCCQPTCCGSSCGQSSSCAPVYCRRTCYHPTSVCLPGCLNQS
  CGSNCCQPCCRPACCETTCCRTTCFQPTCVYSCCQPSCC

• Sequence length: 159

Pathways

Reactome Pathway:

Keratinization

Related Genes

No strongly related genes found yet for KRTAP9-3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KRTAP9-3.