KRTAP5-3 (keratin associated protein 5-3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387266
Gene name Keratin associated protein 5-3
Gene symbol KRTAP5-3
Synonyms (NCBI Gene)
KRTAP5-9KRTAP5.3
Chromosome 11
Chromosome location 11p15.5
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT029068 hsa-miR-26b-5p Microarray 19088304
MIRT1102108 hsa-miR-1197 CLIP-seq
MIRT1102109 hsa-miR-4436a CLIP-seq
MIRT1102109 hsa-miR-4436a CLIP-seq
MIRT1102108 hsa-miR-1197 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6L8H2
Protein name Keratin-associated protein 5-3 (Keratin-associated protein 5-9) (Keratin-associated protein 5.3) (Keratin-associated protein 5.9) (UHS KerB-like) (Ultrahigh sulfur keratin-associated protein 5.3)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their ex
Family and domains
Tissue specificity TISSUE SPECIFICITY: Restricted to hair root, not detected in any other tissues. {ECO:0000269|PubMed:15144888}.
Sequence 
MGCSGCSGGCGSSCGGCGSSCGGCGSGYGGCGSGCCVPVCCCKPVCCCVPACSCSSCGSC
GGSKGVCGSCGGCKGGCGSCGGSKGGCGSSCCVPVCCSSSCGSCGGSKGVCGFRGGSKGG
CGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKPCCCSSGC
GSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCSSQSSCCVPICCQCKI
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP5-3.

No additional diseases found yet through genes similar to KRTAP5-3.