KRTAP5-11 (keratin associated protein 5-11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440051
Gene name Keratin associated protein 5-11
Gene symbol KRTAP5-11
Synonyms (NCBI Gene)
KRTAP5-5KRTAP5-6KRTAP5.11
Chromosome 11
Chromosome location 11q13.4
miRNA miRNA information provided by mirtarbase database.
15 Show/Hide all (15)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2259080 hsa-miR-4690-3p CLIP-seq
MIRT2390042 hsa-miR-4514 CLIP-seq
MIRT2259080 hsa-miR-4690-3p CLIP-seq
MIRT2390043 hsa-miR-4692 CLIP-seq
MIRT2390044 hsa-miR-4768-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6L8G4
Protein name Keratin-associated protein 5-11 (Keratin-associated protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their ex
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 121 → 155 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Restricted to hair root, not detected in any other tissues. {ECO:0000269|PubMed:15144888}.
Sequence 
MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSC
GGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSS
CCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI
Sequence length 156
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP5-11.

No additional diseases found yet through genes similar to KRTAP5-11.