KRTAP5-10 (keratin associated protein 5-10)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387273
Gene name Keratin associated protein 5-10
Gene symbol KRTAP5-10
Synonyms (NCBI Gene)
KRTAP5.10
Chromosome 11
Chromosome location 11q13.4
miRNA miRNA information provided by mirtarbase database.
5
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2027786 hsa-miR-1245 CLIP-seq
MIRT2027787 hsa-miR-2116 CLIP-seq
MIRT2027788 hsa-miR-3606 CLIP-seq
MIRT2027789 hsa-miR-4420 CLIP-seq
MIRT2027790 hsa-miR-921 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6L8G5
Protein name Keratin-associated protein 5-10 (Keratin-associated protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their ex
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 157 → 201 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in hair root but not in skin. Expressed also in brain and skeletal muscle. {ECO:0000269|PubMed:15144888}.
Sequence 
MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGYGSGCGGCGSSCCVPVCCCKPVCCCVPACS
CSSCGSCGGSKGDCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGS
KGGCGSCGGSKGGCGSCGCSQCNCCKPCCCSSGCGSCCQSSCCNPCCCQSSCCVPVCCQS
SCCKPCCCQSSCCVPVCCQCKI
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP5-10.

No additional diseases found yet through genes similar to KRTAP5-10.