KRTAP4-5 (keratin associated protein 4-5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 85289
• Gene name: Keratin associated protein 4-5
• Gene symbol: KRTAP4-5
• Synonyms (NCBI Gene): KAP4.5, KRTAP4.5
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an

miRNA Show/Hide all (38)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021564	hsa-miR-142-3p	Microarray	17612493
MIRT1102067	hsa-miR-181a	CLIP-seq
MIRT1102068	hsa-miR-181b	CLIP-seq
MIRT1102069	hsa-miR-181c	CLIP-seq
MIRT1102070	hsa-miR-181d	CLIP-seq
MIRT1102071	hsa-miR-3160-3p	CLIP-seq
MIRT1102072	hsa-miR-3617	CLIP-seq
MIRT1102073	hsa-miR-3646	CLIP-seq
MIRT1102074	hsa-miR-376a	CLIP-seq
MIRT1102075	hsa-miR-376b	CLIP-seq
MIRT1102076	hsa-miR-4262	CLIP-seq
MIRT1102077	hsa-miR-4714-5p	CLIP-seq
MIRT1102078	hsa-miR-641	CLIP-seq
MIRT1920577	hsa-miR-128	CLIP-seq
MIRT1920578	hsa-miR-27a	CLIP-seq
MIRT1920579	hsa-miR-27b	CLIP-seq
MIRT1920580	hsa-miR-3591-5p	CLIP-seq
MIRT1920581	hsa-miR-4712-3p	CLIP-seq
MIRT1920577	hsa-miR-128	CLIP-seq
MIRT1920578	hsa-miR-27a	CLIP-seq
MIRT1920579	hsa-miR-27b	CLIP-seq
MIRT1920580	hsa-miR-3591-5p	CLIP-seq
MIRT1920581	hsa-miR-4712-3p	CLIP-seq
MIRT1920577	hsa-miR-128	CLIP-seq
MIRT1920578	hsa-miR-27a	CLIP-seq
MIRT1920579	hsa-miR-27b	CLIP-seq
MIRT1920580	hsa-miR-3591-5p	CLIP-seq
MIRT1920581	hsa-miR-4712-3p	CLIP-seq
MIRT2259070	hsa-miR-1206	CLIP-seq
MIRT2259071	hsa-miR-134	CLIP-seq
MIRT2259072	hsa-miR-145	CLIP-seq
MIRT2259073	hsa-miR-1825	CLIP-seq
MIRT2259074	hsa-miR-199a-5p	CLIP-seq
MIRT2259075	hsa-miR-199b-5p	CLIP-seq
MIRT2259076	hsa-miR-3118	CLIP-seq
MIRT2259077	hsa-miR-3180-5p	CLIP-seq
MIRT2259078	hsa-miR-4255	CLIP-seq
MIRT2259079	hsa-miR-579	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0042633	Process	Hair cycle	IBA
GO:0042633	Process	Hair cycle	IDA	21916889
GO:0045095	Component	Keratin filament	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BYR2
• Protein name: Keratin-associated protein 4-5 (Keratin-associated protein 4.5) (Ultrahigh sulfur keratin-associated protein 4.5)
• Protein function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13885	Keratin_B2_2	35 → 79	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	75 → 119	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	1 → 43	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	105 → 174	Keratin, high sulfur B2 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the hair follicles. {ECO:0000269|PubMed:15955084}.
• Sequence:

  MVSSCCGSVSSEQSCGLENCCRPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSC
  CISSCCRPYCCESSCCRPCCCQTTCCRTTCCRTTCCCPSCCVSSCCRPQCCQSVCCQPTC
  CRPSCCISSCCHPSCCESSCCRPCCCVRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSC
  C

• Sequence length: 181

Pathways

Reactome Pathway:

Keratinization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CHRONIC FATIGUE SYNDROME	—	GWAS catalog	35318112	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for KRTAP4-5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KRTAP4-5.