KRTAP4-4 (keratin associated protein 4-4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84616
• Gene name: Keratin associated protein 4-4
• Gene symbol: KRTAP4-4
• Synonyms (NCBI Gene): KAP4.13, KAP4.4, KRTAP4-13, KRTAP4.13, KRTAP4.4
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an

miRNA Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019147	hsa-miR-335-5p	Microarray	18185580
MIRT2027767	hsa-miR-1207-3p	CLIP-seq
MIRT2027768	hsa-miR-646	CLIP-seq
MIRT2259060	hsa-miR-214	CLIP-seq
MIRT2259061	hsa-miR-28-5p	CLIP-seq
MIRT2259062	hsa-miR-3139	CLIP-seq
MIRT2259063	hsa-miR-3619-5p	CLIP-seq
MIRT2259064	hsa-miR-4459	CLIP-seq
MIRT2259065	hsa-miR-4633-3p	CLIP-seq
MIRT2259066	hsa-miR-4722-5p	CLIP-seq
MIRT2259067	hsa-miR-708	CLIP-seq
MIRT2259068	hsa-miR-761	CLIP-seq
MIRT2259069	hsa-miR-765	CLIP-seq
MIRT2452780	hsa-miR-1245b-3p	CLIP-seq
MIRT2452781	hsa-miR-15a	CLIP-seq
MIRT2452782	hsa-miR-15b	CLIP-seq
MIRT2452783	hsa-miR-16	CLIP-seq
MIRT2452784	hsa-miR-195	CLIP-seq
MIRT2452785	hsa-miR-198	CLIP-seq
MIRT2259060	hsa-miR-214	CLIP-seq
MIRT2452786	hsa-miR-2277-3p	CLIP-seq
MIRT2259063	hsa-miR-3619-5p	CLIP-seq
MIRT2452787	hsa-miR-424	CLIP-seq
MIRT2452788	hsa-miR-4291	CLIP-seq
MIRT2452789	hsa-miR-451b	CLIP-seq
MIRT2452790	hsa-miR-497	CLIP-seq
MIRT2259068	hsa-miR-761	CLIP-seq
MIRT2452791	hsa-miR-922	CLIP-seq
MIRT2452780	hsa-miR-1245b-3p	CLIP-seq
MIRT2452781	hsa-miR-15a	CLIP-seq
MIRT2452782	hsa-miR-15b	CLIP-seq
MIRT2452783	hsa-miR-16	CLIP-seq
MIRT2452784	hsa-miR-195	CLIP-seq
MIRT2452785	hsa-miR-198	CLIP-seq
MIRT2259060	hsa-miR-214	CLIP-seq
MIRT2452786	hsa-miR-2277-3p	CLIP-seq
MIRT2259063	hsa-miR-3619-5p	CLIP-seq
MIRT2452787	hsa-miR-424	CLIP-seq
MIRT2452788	hsa-miR-4291	CLIP-seq
MIRT2452789	hsa-miR-451b	CLIP-seq
MIRT2452790	hsa-miR-497	CLIP-seq
MIRT2259068	hsa-miR-761	CLIP-seq
MIRT2452791	hsa-miR-922	CLIP-seq
MIRT2452780	hsa-miR-1245b-3p	CLIP-seq
MIRT2452781	hsa-miR-15a	CLIP-seq
MIRT2452782	hsa-miR-15b	CLIP-seq
MIRT2452783	hsa-miR-16	CLIP-seq
MIRT2452784	hsa-miR-195	CLIP-seq
MIRT2452785	hsa-miR-198	CLIP-seq
MIRT2259060	hsa-miR-214	CLIP-seq
MIRT2452786	hsa-miR-2277-3p	CLIP-seq
MIRT2259063	hsa-miR-3619-5p	CLIP-seq
MIRT2452787	hsa-miR-424	CLIP-seq
MIRT2452788	hsa-miR-4291	CLIP-seq
MIRT2452789	hsa-miR-451b	CLIP-seq
MIRT2452790	hsa-miR-497	CLIP-seq
MIRT2259068	hsa-miR-761	CLIP-seq
MIRT2452791	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0042633	Process	Hair cycle	IBA
GO:0045095	Component	Keratin filament	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BYR3
• Protein name: Keratin-associated protein 4-4 (Keratin-associated protein 4-13) (Keratin-associated protein 4.13) (Keratin-associated protein 4.4) (Ultrahigh sulfur keratin-associated protein 4.13) (Ultrahigh sulfur keratin-associated protein 4.4)
• Protein function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13885	Keratin_B2_2	70 → 119	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	40 → 89	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	2 → 49	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	85 → 134	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	126 → 166	Keratin, high sulfur B2 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the hair follicles. {ECO:0000269|PubMed:15955084}.
• Sequence:

  MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTC
  CHPSCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTC
  CCPSYCVSSCCRPQCCQTTCCRTTCCRPSCCVSRCYRPHCGQSLCC

• Sequence length: 166

Pathways

Reactome Pathway:

Keratinization

Related Genes

No strongly related genes found yet for KRTAP4-4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KRTAP4-4.