KRTAP4-3 (keratin associated protein 4-3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85290
Gene name Keratin associated protein 4-3
Gene symbol KRTAP4-3
Synonyms (NCBI Gene)
KAP4.3
Chromosome 17
Chromosome location 17q21.2
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1102064 hsa-miR-3123 CLIP-seq
MIRT1102065 hsa-miR-3163 CLIP-seq
MIRT1102066 hsa-miR-4311 CLIP-seq
MIRT2027766 hsa-miR-3647-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0042633 Process Hair cycle IBA
GO:0042633 Process Hair cycle IDA 21916889
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYR4
Protein name Keratin-associated protein 4-3 (Keratin-associated protein 4.3) (Ultrahigh sulfur keratin-associated protein 4.3)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 19 → 63 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 59 → 103 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 49 → 93 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 99 → 143 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 131 → 175 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in the middle/uper portions of the hair cortex. Not detected in the hair matrix or cuticle. {ECO:0000269|PubMed:15955084}.
Sequence 
MVSSCCGSVCSDQSCGQGLGQESCCRPSCCQTTCCRTTCCRPSCCISSCCRPSCCISSCC
KPSCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCRTTCCRPSCCISSCCRPSCCISSCC
KPSCCQTTCCRPSCCISSCYRPQCCQPSCCRPACCISSCCHPSCCVSSCRCPFSCPTTCC
RTTCFHPICCGSSCC
Sequence length 195
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP4-3.

No additional diseases found yet through genes similar to KRTAP4-3.