KRTAP4-2 (keratin associated protein 4-2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 85291
Gene name Keratin associated protein 4-2
Gene symbol KRTAP4-2
Synonyms (NCBI Gene)
KAP4.2KRTAP4.2
Chromosome 17
Chromosome location 17q21.2
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an
miRNA miRNA information provided by mirtarbase database.
15 Show/Hide all (15)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017266 hsa-miR-335-5p Microarray 18185580
MIRT025650 hsa-miR-7-5p Microarray 17612493
MIRT528075 hsa-miR-3926 PAR-CLIP 22012620
MIRT528074 hsa-miR-92a-1-5p PAR-CLIP 22012620
MIRT528075 hsa-miR-3926 PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 26871637, 29892012, 31515488, 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0042633 Process Hair cycle IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYR5
Protein name Keratin-associated protein 4-2 (Keratin-associated protein 4.2) (Ultrahigh sulfur keratin-associated protein 4.2)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 55 → 99 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 15 → 59 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 2 → 48 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 96 → 136 Keratin, high sulfur B2 protein Family
Sequence 
MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTC
CSPSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVYCQPTCCRPSCGQTTCCRTTCYRPSC
CVSTCCRPTCSSGSCC
Sequence length 136
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP4-2.

No additional diseases found yet through genes similar to KRTAP4-2.