Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	643803
Gene name	Keratin associated protein 24-1
Gene symbol	KRTAP24-1
Synonyms (NCBI Gene)	KAP24.1
Chromosome	21
Chromosome location	21q22.11

43 Show/Hide all (43)

miRTarBase ID	miRNA	Experiments
MIRT1102001	hsa-miR-2355-5p	CLIP-seq
MIRT1102002	hsa-miR-31	CLIP-seq
MIRT1102003	hsa-miR-3682-3p	CLIP-seq
MIRT1102004	hsa-miR-411	CLIP-seq
MIRT1921250	hsa-miR-1276	CLIP-seq
MIRT1921251	hsa-miR-214	CLIP-seq
MIRT1921252	hsa-miR-3619-5p	CLIP-seq
MIRT1921253	hsa-miR-4291	CLIP-seq
MIRT1921254	hsa-miR-4311	CLIP-seq
MIRT1921255	hsa-miR-4427	CLIP-seq
MIRT1921256	hsa-miR-583	CLIP-seq
MIRT1921257	hsa-miR-761	CLIP-seq
MIRT1921258	hsa-miR-922	CLIP-seq
MIRT1921250	hsa-miR-1276	CLIP-seq
MIRT2438278	hsa-miR-1299	CLIP-seq
MIRT2438279	hsa-miR-135a	CLIP-seq
MIRT2438280	hsa-miR-135b	CLIP-seq
MIRT1921251	hsa-miR-214	CLIP-seq
MIRT2438281	hsa-miR-326	CLIP-seq
MIRT2438282	hsa-miR-330-5p	CLIP-seq
MIRT1921252	hsa-miR-3619-5p	CLIP-seq
MIRT1921253	hsa-miR-4291	CLIP-seq
MIRT1921254	hsa-miR-4311	CLIP-seq
MIRT1921255	hsa-miR-4427	CLIP-seq
MIRT1921256	hsa-miR-583	CLIP-seq
MIRT1921257	hsa-miR-761	CLIP-seq
MIRT2438283	hsa-miR-875-3p	CLIP-seq
MIRT1921258	hsa-miR-922	CLIP-seq
MIRT2438284	hsa-miR-942	CLIP-seq
MIRT1921250	hsa-miR-1276	CLIP-seq
MIRT1921251	hsa-miR-214	CLIP-seq
MIRT1921252	hsa-miR-3619-5p	CLIP-seq
MIRT1921253	hsa-miR-4291	CLIP-seq
MIRT1921254	hsa-miR-4311	CLIP-seq
MIRT1921255	hsa-miR-4427	CLIP-seq
MIRT1921256	hsa-miR-583	CLIP-seq
MIRT1921257	hsa-miR-761	CLIP-seq
MIRT1921258	hsa-miR-922	CLIP-seq
MIRT2559540	hsa-miR-194	CLIP-seq
MIRT2559541	hsa-miR-323b-5p	CLIP-seq
MIRT2559542	hsa-miR-3929	CLIP-seq
MIRT2559543	hsa-miR-4419b	CLIP-seq
MIRT2559544	hsa-miR-4478	CLIP-seq

GO ID	Ontology	Definition	Evidence
GO:0005198	Function	Structural molecule activity	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0045095	Component	Keratin filament	IEA

MIM	HGNC	e!Ensembl
618927	33902	ENSG00000188694

Q3LI83

Protein name

Keratin-associated protein 24-1

Protein function

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05287	PMG	6 → 191	PMG protein	Family

Tissue specificity

TISSUE SPECIFICITY: Specific expression in the middle/upper hair cuticle. {ECO:0000269|PubMed:17235325}.

Sequence

MPAGSMSTTGYPGVCSTTSYRTHCYIPVTSSVTLSSSDLSPTFGHCLPSSYQGNLWLLDY
CQESYGEAPTCKSPSCEPKTCSTTGCDPSNSSVPCNSPSAGQVFSVCETTNVSPSPSCSP
STQTNGYVCNCHIPTRNASKACQTLRNGSNCFGQLNCLSKSFQTLNHCRLSTLGYKSYQN
PCFIPSYVSPLCYISNSCQPQSYLVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPP
LRYLCSGSRPLKCY

Sequence length

254

Interactions

View interactions

Reactome Pathway
Keratinization

Related Genes Genes most often co-reported with KRTAP24-1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for KRTAP24-1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to KRTAP24-1 (see Related Genes above), that are NOT already directly curated for KRTAP24-1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to KRTAP24-1.

KRTAP24-1 (keratin associated protein 24-1)

Bookmark This Gene