KRTAP21-3 (keratin associated protein 21-3)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100288323 |
| Gene name | Keratin associated protein 21-3 |
| Gene symbol | KRTAP21-3 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 21 |
| Chromosome location | 21q22.11 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
|
||||||||||||||||
|
||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q3LHN1 |
| Protein name | Keratin-associated protein 21-3 |
| Protein function | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e |
| Family and domains | |
| Sequence |
MYFNYKSVCGSCGFGSCYGCGYGCIHSTHCGCNGYYGCYENKYSVIDDLIFFASKKCH |
| Sequence length | 58 |
| Interactions | View interactions |
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
|||
|
|||
|
Related Genes
Genes most often co-reported with KRTAP21-3 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to KRTAP21-3 (see Related Genes above), that are NOT already directly curated for KRTAP21-3 itself -- a lead worth checking, not a confirmed association.
0
|
|