KRTAP12-4 (keratin associated protein 12-4)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 386684 |
| Gene name | Keratin associated protein 12-4 |
| Gene symbol | KRTAP12-4 |
| Synonyms (NCBI Gene) |
KRTAP12.4
|
| Chromosome | 21 |
| Chromosome location | 21q22.3 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P60329 |
| Protein name | Keratin-associated protein 12-4 (High sulfur keratin-associated protein 12.4) (Keratin-associated protein 12.4) |
| Protein function | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:1502 |
| Sequence |
MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPAC |
| Sequence length | 112 |
| Interactions | View interactions |
|
Pathways
Pathway information has different metabolic/signaling pathways associated with genes.
|
|||
|
|||
|
Related Genes
Genes most often co-reported with KRTAP12-4 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to KRTAP12-4 (see Related Genes above), that are NOT already directly curated for KRTAP12-4 itself -- a lead worth checking, not a confirmed association.
0
|
|