KRTAP12-2 (keratin associated protein 12-2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 353323
Gene name Keratin associated protein 12-2
Gene symbol KRTAP12-2
Synonyms (NCBI Gene)
KAP12.2KRTAP12.2
Chromosome 21
Chromosome location 21q22.3
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT042738 hsa-miR-339-5p CLASH 23622248
MIRT1101975 hsa-miR-3130-3p CLIP-seq
MIRT1101976 hsa-miR-3192 CLIP-seq
MIRT1101977 hsa-miR-4300 CLIP-seq
MIRT1101978 hsa-miR-4793-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 26871637, 31515488, 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P59991
Protein name Keratin-associated protein 12-2 (High sulfur keratin-associated protein 12.2) (Keratin-associated protein 12.2)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05287 PMG 2 → 134 PMG protein Family
Tissue specificity TISSUE SPECIFICITY: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:1502
Sequence 
MCHTSCSSGCQPACCAPSPCQPACCVPSSCQASCCVPVGCQSSVCVPVSFKPAVCLPVSC
QSSVCVPMSFKSAVCVPVSCQSSVCVPVSCRPIVCAAPSCQSSLCVPVSCRPVVYAAPSC
QSSGCCQPSCTSVLCRPISYSISSCC
Sequence length 146
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP12-2.

No additional diseases found yet through genes similar to KRTAP12-2.