KRTAP10-5 (keratin associated protein 10-5)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 386680
• Gene name: Keratin associated protein 10-5
• Gene symbol: KRTAP10-5
• Synonyms (NCBI Gene): KAP10.5, KAP18-5, KAP18.5, KRTAP10.5, KRTAP18-5, KRTAP18.1, KRTAP18.5
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: This is an intronless gene located in a cluster of related genes on the q arm of chromosome 21. The proteins encoded by these genes form disulfide bonds with cysteine residues in hair keratins, thereby contributing to the structure and stability of hair f

miRNA Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1101919	hsa-miR-1275	CLIP-seq
MIRT1101920	hsa-miR-1291	CLIP-seq
MIRT1101921	hsa-miR-328	CLIP-seq
MIRT1101922	hsa-miR-4292	CLIP-seq
MIRT1101923	hsa-miR-4525	CLIP-seq
MIRT1101924	hsa-miR-4665-5p	CLIP-seq
MIRT1101925	hsa-miR-4723-5p	CLIP-seq
MIRT1101926	hsa-miR-4764-5p	CLIP-seq
MIRT1101927	hsa-miR-625	CLIP-seq
MIRT1101928	hsa-miR-637	CLIP-seq
MIRT2027716	hsa-miR-3176	CLIP-seq
MIRT2027717	hsa-miR-3654	CLIP-seq
MIRT2027718	hsa-miR-378	CLIP-seq
MIRT2027719	hsa-miR-378b	CLIP-seq
MIRT2027720	hsa-miR-378c	CLIP-seq
MIRT2027721	hsa-miR-378d	CLIP-seq
MIRT2027722	hsa-miR-378e	CLIP-seq
MIRT2027723	hsa-miR-378f	CLIP-seq
MIRT2027724	hsa-miR-378h	CLIP-seq
MIRT2027725	hsa-miR-378i	CLIP-seq
MIRT2027726	hsa-miR-3922-3p	CLIP-seq
MIRT2027727	hsa-miR-422a	CLIP-seq
MIRT2027728	hsa-miR-4468	CLIP-seq
MIRT2027716	hsa-miR-3176	CLIP-seq
MIRT2027717	hsa-miR-3654	CLIP-seq
MIRT2027718	hsa-miR-378	CLIP-seq
MIRT2027719	hsa-miR-378b	CLIP-seq
MIRT2027720	hsa-miR-378c	CLIP-seq
MIRT2027721	hsa-miR-378d	CLIP-seq
MIRT2027722	hsa-miR-378e	CLIP-seq
MIRT2027723	hsa-miR-378f	CLIP-seq
MIRT2027724	hsa-miR-378h	CLIP-seq
MIRT2027725	hsa-miR-378i	CLIP-seq
MIRT2027726	hsa-miR-3922-3p	CLIP-seq
MIRT2027727	hsa-miR-422a	CLIP-seq
MIRT2027728	hsa-miR-4468	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 32296183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956
GO:0045095	Component	Keratin filament	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: P60370
• Protein name: Keratin-associated protein 10-5 (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5)
• Protein function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13885	Keratin_B2_2	182 → 228	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	148 → 191	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	106 → 149	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	66 → 109	Keratin, high sulfur B2 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:1502
• Sequence:

  MAACTMSVCSSACSDSWRVDDCPESCCEPPCGTAPCLTLVCTPVSCVSSPCCQAACEPSP
  CQSGCTSSCTPSCCQPACCASSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTC
  CASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCCKP
  VCFKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPICRPACCVPISSC
  CAPASSYQASCCRPASCVSLLCRPACSRLAC

• Sequence length: 271

Related Genes

No strongly related genes found yet for KRTAP10-5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KRTAP10-5.