KRTAP10-4 (keratin associated protein 10-4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 386672
Gene name Keratin associated protein 10-4
Gene symbol KRTAP10-4
Synonyms (NCBI Gene)
KAP10.4KAP18-4KRTAP10.4KRTAP18-4KRTAP18.4
Chromosome 21
Chromosome location 21q22.3
Summary This is an intronless gene located in a cluster of related genes on the q arm of chromosome 21. The proteins encoded by these genes form disulfide bonds with cysteine residues in hair keratins, thereby contributing to the structure and stability of hair f
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017983 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0045095 Component Keratin filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P60372
Protein name Keratin-associated protein 10-4 (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 202 → 245 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 246 → 294 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 89 → 133 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 292 → 336 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 339 → 401 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Restricted to hair root, not detected in any other tissues.
Sequence 
MSVCSSDLSYSSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPSCCAPAPCLSLVCTPV
SRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCC
KPVCCVPVCCGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVS
CVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSSSCQQACCVPVCCKTVCCK
PVCSEDSSSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCKPVGSVPICSGASSLCCQQ
SSCQPACCTSSQSQQGCCVPVCCKPVSCVPVCSGASSSCCQQSSCQPACCTTSCCRPSSS
VSLLCRPVCRPACCVPVPSCCAPTSSCQPSCCRPASCVSLL
Sequence length 401
Interactions View interactions

No strongly related genes found yet for KRTAP10-4.

No additional diseases found yet through genes similar to KRTAP10-4.