KRTAP10-2 (keratin associated protein 10-2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 386679
• Gene name: Keratin associated protein 10-2
• Gene symbol: KRTAP10-2
• Synonyms (NCBI Gene): KAP10.2, KAP18-2, KAP18.2, KRTAP10.2, KRTAP18-2, KRTAP18.2
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: This gene encodes a member of the high sulfur-type keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. This gene is located in a cluster of similar gen

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016747	hsa-miR-335-5p	Microarray	18185580
MIRT1101896	hsa-miR-1184	CLIP-seq
MIRT1101897	hsa-miR-1237	CLIP-seq
MIRT1101898	hsa-miR-1248	CLIP-seq
MIRT1101899	hsa-miR-3150b-3p	CLIP-seq
MIRT1101900	hsa-miR-3182	CLIP-seq
MIRT1101901	hsa-miR-3200-5p	CLIP-seq
MIRT1101902	hsa-miR-3652	CLIP-seq
MIRT1101903	hsa-miR-3919	CLIP-seq
MIRT1101904	hsa-miR-4268	CLIP-seq
MIRT1101905	hsa-miR-4283	CLIP-seq
MIRT1101906	hsa-miR-4430	CLIP-seq
MIRT1101907	hsa-miR-4448	CLIP-seq
MIRT1101908	hsa-miR-4474-3p	CLIP-seq
MIRT1101909	hsa-miR-4489	CLIP-seq
MIRT1101910	hsa-miR-4505	CLIP-seq
MIRT1101911	hsa-miR-4676-5p	CLIP-seq
MIRT1101912	hsa-miR-4685-5p	CLIP-seq
MIRT1101913	hsa-miR-4689	CLIP-seq
MIRT1101914	hsa-miR-4707-3p	CLIP-seq
MIRT1101915	hsa-miR-4731-5p	CLIP-seq
MIRT1101916	hsa-miR-4756-3p	CLIP-seq
MIRT1101917	hsa-miR-4784	CLIP-seq
MIRT1101918	hsa-miR-575	CLIP-seq
MIRT1101902	hsa-miR-3652	CLIP-seq
MIRT1101906	hsa-miR-4430	CLIP-seq
MIRT1101910	hsa-miR-4505	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IEA
GO:0045095	Component	Keratin filament	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: P60368
• Protein name: Keratin-associated protein 10-2 (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2)
• Protein function: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13885	Keratin_B2_2	74 → 118	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	158 → 206	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	196 → 238	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	116 → 161	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	209 → 255	Keratin, high sulfur B2 protein	Family
  PF13885	Keratin_B2_2	16 → 61	Keratin, high sulfur B2 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:1502
• Sequence:

  MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQA
  ACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSC
  CQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQ
  SCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCS
  RPASCSFSSGQKSSC

• Sequence length: 255

Pathways

Reactome Pathway:

Keratinization

Related Genes

No strongly related genes found yet for KRTAP10-2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KRTAP10-2.