KRTAP1-1 (keratin associated protein 1-1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 81851
Gene name Keratin associated protein 1-1
Gene symbol KRTAP1-1
Synonyms (NCBI Gene)
HB2AKAP1.1KAP1.1AKAP1.1BKAP1.6KAP1.7KRTAP1.1KRTAP1AhKAP1.7
Chromosome 17
Chromosome location 17q21.2
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1101963 hsa-miR-4477a CLIP-seq
MIRT1101964 hsa-miR-513a-3p CLIP-seq
MIRT2559539 hsa-miR-618 CLIP-seq
MIRT2559539 hsa-miR-618 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
GO:0005882 Component Intermediate filament IEA
GO:0045095 Component Keratin filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608819 16772 ENSG00000188581
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07627
Protein name Keratin-associated protein 1-1 (High sulfur keratin-associated protein 1.1) (Keratin-associated protein 1.1) (Keratin-associated protein 1.6) (Keratin-associated protein 1.7)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01500 Keratin_B2 68 → 177 Keratin, high sulfur B2 protein Family
PF01500 Keratin_B2 1 → 49 Keratin, high sulfur B2 protein Family
PF01500 Keratin_B2 47 → 88 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the middle/upper portions of the hair cortex, in the region termed the keratogenous zone. {ECO:0000269|PubMed:11279113}.
Sequence 
MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSSCQPRCCETSCCQPSCCQTSFCGFPSF
STGGTCDSSCCQPSCCETSCCQPSCYQTSSCGTGCGIGGGIGYGQEGSSGAVSTRIRWCR
PDCRVEGTCLPPCCVVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPVCCCYCSEPTC
Sequence length 177
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Keratinization

No strongly related genes found yet for KRTAP1-1.

No additional diseases found yet through genes similar to KRTAP1-1.