KLRF1 (killer cell lectin like receptor F1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51348
Gene name Killer cell lectin like receptor F1
Gene symbol KLRF1
Synonyms (NCBI Gene)
CLEC5CNKp80
Chromosome 12
Chromosome location 12p13.31
Summary KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulates their cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]).[supplied by OMIM, Oct 2009]
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017754 hsa-miR-335-5p Microarray 18185580
MIRT2258176 hsa-miR-548p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity IDA 17057721
GO:0004888 Function Transmembrane signaling receptor activity TAS 10671213
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IC 17057721
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605029 13342 ENSG00000150045
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZS2
Protein name Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)
Protein function Functions as an activating receptor involved in immunosurveillance upon binding to various ligands displayed at the surface of myeloid cells. Upon interaction with CLEC2B ligand, stimulates NK-cell cytotoxicity and cytokine production leading to
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 131 → 231 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in peripheral blood leukocytes and spleen, with weaker expression in lymph node and adult liver, and no expression detected in bone marrow, thymus, and fetal liver. Not expressed in brain, heart, placenta, lung, kidn
Sequence 
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLIL
LVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
YQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSL
KMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY
Sequence length 231
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

No strongly related genes found yet for KLRF1.

No additional diseases found yet through genes similar to KLRF1.