KLKP1 (kallikrein pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 606293
Gene name Kallikrein pseudogene 1
Gene symbol KLKP1
Synonyms (NCBI Gene)
KARMAKLK31PKRSP1PsiKLK1YKLK1
Chromosome 19
Chromosome location 19q13.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q107X0
Protein name Putative protein KRIP1 (Kallikrein-related in prostate protein 1) (Kallikrein-related mRNA protein) (KARMA)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Abundant expression is found in prostate, restricted to cells of epithelial origin in normal and diseased glands. Very low expression is detected in pancreas and ovary. {ECO:0000269|PubMed:18196551}.
Sequence 
MSPVHRSRTSQTQEAHKPTSTLSFISPPQPPRQDPKSPHILCSQPNACSRQSHVSYPNPW
GLPCSQSKVSPPGTATNPNPKEWSRISGPPVSLDPQPWSSAPFKPTAQLPLLAQSLGPPA
KPALPDPALPLQML
Sequence length 134
Interactions View interactions

No strongly related genes found yet for KLKP1.

No additional diseases found yet through genes similar to KLKP1.