KLK9 (kallikrein related peptidase 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284366
Gene name Kallikrein related peptidase 9
Gene symbol KLK9
Synonyms (NCBI Gene)
KLK-L3KLKL3
Chromosome 19
Chromosome location 19q13.41
Summary The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm.
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1099101 hsa-miR-1471 CLIP-seq
MIRT1099102 hsa-miR-3173-3p CLIP-seq
MIRT1099103 hsa-miR-3689d CLIP-seq
MIRT1099101 hsa-miR-1471 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004252 Function Serine-type endopeptidase activity IBA
GO:0004252 Function Serine-type endopeptidase activity IEA
GO:0004252 Function Serine-type endopeptidase activity NAS 11054574
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
605504 6370 ENSG00000213022
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKQ9
Protein name Kallikrein-9 (EC 3.4.21.-) (Kallikrein-like protein 3) (KLK-L3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00089 Trypsin 23 → 244 Trypsin Domain
Tissue specificity TISSUE SPECIFICITY: Skin, thymus, trachea, cerebellum and spinal cord.
Sequence 
MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLT
AAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQ
ARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP
GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY
LDWIQEIMEN
Sequence length 250
Interactions View interactions

No strongly related genes found yet for KLK9.

No additional diseases found yet through genes similar to KLK9.