KLHL35 (kelch like family member 35)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283212
Gene name Kelch like family member 35
Gene symbol KLHL35
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q13.4
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018223 hsa-miR-335-5p Microarray 18185580
MIRT2389968 hsa-miR-4418 CLIP-seq
MIRT2389969 hsa-miR-509-3-5p CLIP-seq
MIRT2389970 hsa-miR-509-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183, 32814053
GO:0005737 Component Cytoplasm IBA
GO:0031463 Component Cul3-RING ubiquitin ligase complex IBA
GO:0043161 Process Proteasome-mediated ubiquitin-dependent protein catabolic process IBA
GO:1990756 Function Ubiquitin-like ligase-substrate adaptor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PF15
Protein name Kelch-like protein 35
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 31 → 150 BTB/POZ domain Domain
PF01344 Kelch_1 384 → 428 Kelch motif Repeat
PF01344 Kelch_1 339 → 381 Kelch motif Repeat
PF01344 Kelch_1 430 → 476 Kelch motif Repeat
PF01344 Kelch_1 522 → 566 Kelch motif Repeat
PF07707 BACK 155 → 257 BTB And C-terminal Kelch Domain
Sequence 
MRQGHAPEESEPGCEAPCAGPCHAQRVLQALNAYRRSGTLTDVVLRAGGRDFPCHRAALS
AGSAYFRSLFAAGRPERGPAVVPVVPVAPEAPGTSPAGAAAALAVVLDYVYGAGVRLRAE
DEAAAVLALAERLGVAGLREACVRFLEGRLRAANSLALRRVAAAFSLAPLAERCGRVLRQ
AFAEVARHADFLELAPDEVVALLADPALGVAREEAVFEAAMRWVRHDAPARRGQLRRLLE
HVRLPLLAPAYFLEKVEADELLQACGECRPLLLEARACFILGREAGALRTRPRRFMDLAE
VIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTRSEFAACALRNDVYVSGGHIN
SHDVWMFSSHLHTWIKVASLHKGRWRHKMAVVQGQLFAVGGFDGLRRLHSVERYDPFSNT
WAAAAPLPEAVSSAAVASCAGKLFVIGGARQGGVNTDKVQCFDPKEDRWSLRSPAPFSQR
CLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRD
DRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR
Sequence length 583
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Acute myeloid leukemia Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (9)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aortic Aneurysm Abdominal Aortic aneurysm Pubtator 25993294 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 25993294
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 22457049 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37158531 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 21132003
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 22457049
★★★★★
★☆☆☆☆
Found in Text Mining only
Lung Diseases Lung disease Pubtator 35500859 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21132003
★★★★★
★☆☆☆☆
Found in Text Mining only
Renal Cell Carcinoma Renal Carcinoma BEFREE 21132003
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for KLHL35.

No additional diseases found yet through genes similar to KLHL35.