KLHL30-AS1 (KLHL30 antisense RNA 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 394261 |
| Gene name | KLHL30 antisense RNA 1 |
| Gene symbol | KLHL30-AS1 |
| Synonyms (NCBI Gene) |
C2orf19
|
| Chromosome | 2 |
| Chromosome location | 2q37.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8NEE0 |
| Protein name | Putative uncharacterized protein KLHL30-AS1 (KLHL30 antisense RNA 1) |
| Family and domains | |
| Sequence |
MCLRSHFKVAFTQRKVELSKELRRSRSSRNGGLPLQEQPMGQKWGWHRGEPGHPRMEELN |
| Sequence length | 82 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with KLHL30-AS1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to KLHL30-AS1 (see Related Genes above), that are NOT already directly curated for KLHL30-AS1 itself -- a lead worth checking, not a confirmed association.
0
|
|