Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	114818
Gene name	Kelch like family member 29
Gene symbol	KLHL29
Synonyms (NCBI Gene)	KBTBD9
Chromosome	2
Chromosome location	2p24.1

71 Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440355	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440355	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT1098381	hsa-miR-1	CLIP-seq
MIRT1098382	hsa-miR-103a	CLIP-seq
MIRT1098383	hsa-miR-107	CLIP-seq
MIRT1098384	hsa-miR-1179	CLIP-seq
MIRT1098385	hsa-miR-1200	CLIP-seq
MIRT1098386	hsa-miR-1263	CLIP-seq
MIRT1098387	hsa-miR-146b-3p	CLIP-seq
MIRT1098388	hsa-miR-1976	CLIP-seq
MIRT1098389	hsa-miR-206	CLIP-seq
MIRT1098390	hsa-miR-3123	CLIP-seq
MIRT1098391	hsa-miR-3130-3p	CLIP-seq
MIRT1098392	hsa-miR-3173-5p	CLIP-seq
MIRT1098393	hsa-miR-3668	CLIP-seq
MIRT1098394	hsa-miR-3673	CLIP-seq
MIRT1098395	hsa-miR-376c	CLIP-seq
MIRT1098396	hsa-miR-3925-5p	CLIP-seq
MIRT1098397	hsa-miR-421	CLIP-seq
MIRT1098398	hsa-miR-4272	CLIP-seq
MIRT1098399	hsa-miR-4279	CLIP-seq
MIRT1098400	hsa-miR-4308	CLIP-seq
MIRT1098401	hsa-miR-4310	CLIP-seq
MIRT1098402	hsa-miR-4324	CLIP-seq
MIRT1098403	hsa-miR-4448	CLIP-seq
MIRT1098404	hsa-miR-4467	CLIP-seq
MIRT1098405	hsa-miR-4709-5p	CLIP-seq
MIRT1098406	hsa-miR-4722-3p	CLIP-seq
MIRT1098407	hsa-miR-4732-5p	CLIP-seq
MIRT1098408	hsa-miR-4778-5p	CLIP-seq
MIRT1098409	hsa-miR-4793-3p	CLIP-seq
MIRT1098410	hsa-miR-544	CLIP-seq
MIRT1098411	hsa-miR-544b	CLIP-seq
MIRT1098412	hsa-miR-613	CLIP-seq
MIRT1098413	hsa-miR-874	CLIP-seq
MIRT2026745	hsa-miR-1827	CLIP-seq
MIRT2026746	hsa-miR-2909	CLIP-seq
MIRT1098390	hsa-miR-3123	CLIP-seq
MIRT2026747	hsa-miR-3162-5p	CLIP-seq
MIRT2026748	hsa-miR-3194-5p	CLIP-seq
MIRT2026749	hsa-miR-323b-5p	CLIP-seq
MIRT2026750	hsa-miR-3612	CLIP-seq
MIRT1098393	hsa-miR-3668	CLIP-seq
MIRT1098396	hsa-miR-3925-5p	CLIP-seq
MIRT2026751	hsa-miR-4323	CLIP-seq
MIRT2026752	hsa-miR-4433	CLIP-seq
MIRT2026753	hsa-miR-4459	CLIP-seq
MIRT2026754	hsa-miR-4695-5p	CLIP-seq
MIRT1098407	hsa-miR-4732-5p	CLIP-seq
MIRT2026755	hsa-miR-4768-3p	CLIP-seq
MIRT2026756	hsa-miR-502-5p	CLIP-seq
MIRT2026757	hsa-miR-650	CLIP-seq
MIRT2558919	hsa-miR-1258	CLIP-seq
MIRT2558920	hsa-miR-129-3p	CLIP-seq
MIRT2558921	hsa-miR-1913	CLIP-seq
MIRT2558922	hsa-miR-2113	CLIP-seq
MIRT2558923	hsa-miR-218	CLIP-seq
MIRT2558924	hsa-miR-2682	CLIP-seq
MIRT2558925	hsa-miR-3143	CLIP-seq
MIRT1098392	hsa-miR-3173-5p	CLIP-seq
MIRT2558926	hsa-miR-3189-5p	CLIP-seq
MIRT2558927	hsa-miR-324-3p	CLIP-seq
MIRT2558928	hsa-miR-3925-3p	CLIP-seq
MIRT2558929	hsa-miR-449c	CLIP-seq
MIRT2558930	hsa-miR-4514	CLIP-seq
MIRT2558931	hsa-miR-4645-5p	CLIP-seq
MIRT2558932	hsa-miR-4673	CLIP-seq
MIRT2558933	hsa-miR-4687-5p	CLIP-seq
MIRT2558934	hsa-miR-4692	CLIP-seq
MIRT2558935	hsa-miR-4758-3p	CLIP-seq
MIRT2558936	hsa-miR-543	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25036637, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q96CT2

Protein name

Kelch-like protein 29 (Kelch repeat and BTB domain-containing protein 9)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	319 → 431	BTB/POZ domain	Domain
PF01344	Kelch_1	672 → 717	Kelch motif	Repeat
PF01344	Kelch_1	810 → 857	Kelch motif	Repeat
PF01344	Kelch_1	719 → 765	Kelch motif	Repeat
PF07707	BACK	436 → 538	BTB And C-terminal Kelch	Domain

Sequence

MSRHHSRFERDYRVGWDRREWSVNGTHGTTSICSVTSGAGGGTASSLSVRPGLLPLPVVP
SRLPTPATAPAPCTTGSSEAITSLVASSASAVTTKAPGISKGDSQSQGLATSIRWGQTPI
NQSTPWDTDEPPSKQMRESDNPGTGPWVTTVAAGNQPTLIAHSYGVAQPPTFSPAVNVQA
PVIGVTPSLPPHVGPQLPLMPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPG
VGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTIG
VGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR
SVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDF
IAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQR
SLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLL
DNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAV
HSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKYAPAVTLNGFV
FILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG

Sequence length

875

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
ASTROCYTOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	28468790	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	30531953	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	30531953	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	21347282	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29942085, 30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	29942085	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30595370, 30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	33111402	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Breast Neoplasms	Breast neoplasm	Pubtator	37845393	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28081303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	GWASCAT_DG	30531953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	36273157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37845393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KLHL29 (kelch like family member 29)

Bookmark This Gene