KCNRG (potassium channel regulator)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283518
Gene name Potassium channel regulator
Gene symbol KCNRG
Synonyms (NCBI Gene)
DLTET
Chromosome 13
Chromosome location 13q14.2
Summary This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isofor
miRNA miRNA information provided by mirtarbase database.
24 Show/Hide all (24)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT717760 hsa-miR-6773-3p HITS-CLIP 19536157
MIRT717759 hsa-miR-215-3p HITS-CLIP 19536157
MIRT717758 hsa-miR-4524a-3p HITS-CLIP 19536157
MIRT717757 hsa-miR-6879-3p HITS-CLIP 19536157
MIRT717756 hsa-miR-7111-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19968958, 32296183
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 19968958
GO:0005783 Component Endoplasmic reticulum IEA
GO:0042802 Function Identical protein binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607947 18893 ENSG00000198553
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N5I3
Protein name Potassium channel regulatory protein (Potassium channel regulator) (Protein CLLD4)
Protein function Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 7 → 98 BTB/POZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous in normal tissues and expressed in some tumor tissues. {ECO:0000269|PubMed:12650944}.
Sequence 
MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSF
ILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQ
AFFRVFGSCSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQC
GSDSTTDNQTGVRYVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSSEDKTECY
SFERIKSPEVLITNETPKPETIIIPEQSQIKK
Sequence length 272
Interactions View interactions

No strongly related genes found yet for KCNRG.

No additional diseases found yet through genes similar to KCNRG.