KCNQ1DN (KCNQ1 downstream neighbor)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 55539 |
| Gene name | KCNQ1 downstream neighbor |
| Gene symbol | KCNQ1DN |
| Synonyms (NCBI Gene) |
BWRTHSA404617
|
| Chromosome | 11 |
| Chromosome location | 11p15.4|11p15.5 |
| Summary | Imprinting is a phenomenon in which epigenetic modifications lead to expression or suppression of alleles of some genes based on their parental origin. Wilms tumor-2 (WT2; MIM 194071) is defined by maternal-specific loss of heterozygosity of a critical re |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9H478 |
| Protein name | KCNQ1 downstream neighbor protein (Beckwith-Wiedemann region transcript protein) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Shows reduced expression in Wilms' tumor samples. {ECO:0000269|PubMed:11056398}. |
| Sequence |
MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSAL |
| Sequence length | 68 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with KCNQ1DN across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to KCNQ1DN (see Related Genes above), that are NOT already directly curated for KCNQ1DN itself -- a lead worth checking, not a confirmed association.
0
|
|