Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3770
Gene name	Potassium inwardly rectifying channel subfamily J member 14
Gene symbol	KCNJ14
Synonyms (NCBI Gene)	IRK4KIR2.4
Chromosome	19
Chromosome location	19q13.33
Summary	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel, and probably has a role

47 Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016626	hsa-miR-484	Sequencing	20371350
MIRT025814	hsa-miR-7-5p	Microarray	19073608
MIRT030614	hsa-miR-24-3p	Sequencing	20371350
MIRT1081415	hsa-miR-1238	CLIP-seq
MIRT1081416	hsa-miR-1262	CLIP-seq
MIRT1081417	hsa-miR-1284	CLIP-seq
MIRT1081418	hsa-miR-1827	CLIP-seq
MIRT1081419	hsa-miR-1972	CLIP-seq
MIRT1081420	hsa-miR-2115	CLIP-seq
MIRT1081421	hsa-miR-2355-5p	CLIP-seq
MIRT1081422	hsa-miR-2682	CLIP-seq
MIRT1081423	hsa-miR-3977	CLIP-seq
MIRT1081424	hsa-miR-412	CLIP-seq
MIRT1081425	hsa-miR-449c	CLIP-seq
MIRT1081426	hsa-miR-4650-5p	CLIP-seq
MIRT1081427	hsa-miR-4701-3p	CLIP-seq
MIRT1081428	hsa-miR-4796-5p	CLIP-seq
MIRT1081429	hsa-miR-516a-3p	CLIP-seq
MIRT1081430	hsa-miR-635	CLIP-seq
MIRT1081420	hsa-miR-2115	CLIP-seq
MIRT2020173	hsa-miR-4780	CLIP-seq
MIRT1081429	hsa-miR-516a-3p	CLIP-seq
MIRT2020174	hsa-miR-623	CLIP-seq
MIRT2251999	hsa-miR-4480	CLIP-seq
MIRT2252000	hsa-miR-4511	CLIP-seq
MIRT2252001	hsa-miR-668	CLIP-seq
MIRT2389652	hsa-miR-4747-5p	CLIP-seq
MIRT2555273	hsa-miR-2052	CLIP-seq
MIRT2555274	hsa-miR-2113	CLIP-seq
MIRT2555275	hsa-miR-4307	CLIP-seq
MIRT2555276	hsa-miR-4777-5p	CLIP-seq
MIRT2555277	hsa-miR-494	CLIP-seq
MIRT2555278	hsa-miR-518d-5p	CLIP-seq
MIRT2555279	hsa-miR-519b-5p	CLIP-seq
MIRT2555280	hsa-miR-519c-5p	CLIP-seq
MIRT2555281	hsa-miR-520c-5p	CLIP-seq
MIRT2555282	hsa-miR-526a	CLIP-seq
MIRT2555273	hsa-miR-2052	CLIP-seq
MIRT2555274	hsa-miR-2113	CLIP-seq
MIRT2555275	hsa-miR-4307	CLIP-seq
MIRT2555276	hsa-miR-4777-5p	CLIP-seq
MIRT2555277	hsa-miR-494	CLIP-seq
MIRT2555278	hsa-miR-518d-5p	CLIP-seq
MIRT2555279	hsa-miR-519b-5p	CLIP-seq
MIRT2555280	hsa-miR-519c-5p	CLIP-seq
MIRT2555281	hsa-miR-520c-5p	CLIP-seq
MIRT2555282	hsa-miR-526a	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IBA
GO:0005242	Function	Inward rectifier potassium channel activity	IEA
GO:0005242	Function	Inward rectifier potassium channel activity	TAS	9592090
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	9592090
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034765	Process	Regulation of monoatomic ion transmembrane transport	IBA
GO:1990573	Process	Potassium ion import across plasma membrane	IBA

MIM	HGNC	e!Ensembl
603953	6260	ENSG00000182324

Q9UNX9

Protein name

ATP-sensitive inward rectifier potassium channel 14 (Inward rectifier K(+) channel Kir2.4) (IRK-4) (Potassium channel, inwardly rectifying subfamily J member 14)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	53 → 191	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	198 → 371	Inward rectifier potassium channel C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed preferentially in retina. {ECO:0000269|PubMed:10942728}.

Sequence

MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP

Sequence length

436

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cholinergic synapse	Classical Kir channels
Oxytocin signaling pathway	Phase 4 - resting membrane potential

KCNJ14 (potassium inwardly rectifying channel subfamily J member 14)

Bookmark This Gene