KCNIP2 (potassium voltage-gated channel interacting protein 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 30819
• Gene name: Potassium voltage-gated channel interacting protein 2
• Gene symbol: KCNIP2
• Synonyms (NCBI Gene): KCHIP2
• Chromosome: 10
• Chromosome location: 10q24.32
• Summary: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have

miRNA Show/Hide all (77)

miRTarBase ID	miRNA	Experiments	Reference
MIRT496849	hsa-miR-6858-3p	PAR-CLIP	22291592
MIRT496847	hsa-miR-4676-5p	PAR-CLIP	22291592
MIRT496848	hsa-miR-575	PAR-CLIP	22291592
MIRT496846	hsa-miR-1825	PAR-CLIP	22291592
MIRT496845	hsa-miR-4251	PAR-CLIP	22291592
MIRT496844	hsa-miR-4786-3p	PAR-CLIP	22291592
MIRT496843	hsa-miR-1253	PAR-CLIP	22291592
MIRT496842	hsa-miR-6770-5p	PAR-CLIP	22291592
MIRT496841	hsa-miR-4480	PAR-CLIP	22291592
MIRT496840	hsa-miR-3194-5p	PAR-CLIP	22291592
MIRT496849	hsa-miR-6858-3p	PAR-CLIP	22291592
MIRT496847	hsa-miR-4676-5p	PAR-CLIP	22291592
MIRT496848	hsa-miR-575	PAR-CLIP	22291592
MIRT496846	hsa-miR-1825	PAR-CLIP	22291592
MIRT496845	hsa-miR-4251	PAR-CLIP	22291592
MIRT496844	hsa-miR-4786-3p	PAR-CLIP	22291592
MIRT496843	hsa-miR-1253	PAR-CLIP	22291592
MIRT496842	hsa-miR-6770-5p	PAR-CLIP	22291592
MIRT496841	hsa-miR-4480	PAR-CLIP	22291592
MIRT496840	hsa-miR-3194-5p	PAR-CLIP	22291592
MIRT1081125	hsa-miR-2110	CLIP-seq
MIRT1081126	hsa-miR-3179	CLIP-seq
MIRT1081127	hsa-miR-3202	CLIP-seq
MIRT1081128	hsa-miR-326	CLIP-seq
MIRT1081129	hsa-miR-330-5p	CLIP-seq
MIRT1081130	hsa-miR-4271	CLIP-seq
MIRT1081131	hsa-miR-4283	CLIP-seq
MIRT1081132	hsa-miR-4502	CLIP-seq
MIRT1081133	hsa-miR-4667-5p	CLIP-seq
MIRT1081134	hsa-miR-4700-5p	CLIP-seq
MIRT1081135	hsa-miR-4725-3p	CLIP-seq
MIRT1081136	hsa-miR-4747-5p	CLIP-seq
MIRT1081137	hsa-miR-637	CLIP-seq
MIRT1081138	hsa-miR-136	CLIP-seq
MIRT1081139	hsa-miR-151-5p	CLIP-seq
MIRT1081140	hsa-miR-151b	CLIP-seq
MIRT1081141	hsa-miR-4455	CLIP-seq
MIRT1081142	hsa-miR-4523	CLIP-seq
MIRT1081143	hsa-miR-4779	CLIP-seq
MIRT1081144	hsa-miR-490-5p	CLIP-seq
MIRT737719	hsa-miR-1470	CLIP-seq
MIRT737715	hsa-miR-1915	CLIP-seq
MIRT737712	hsa-miR-361-3p	CLIP-seq
MIRT737716	hsa-miR-3943	CLIP-seq
MIRT737713	hsa-miR-4270	CLIP-seq
MIRT737720	hsa-miR-432	CLIP-seq
MIRT737714	hsa-miR-4441	CLIP-seq
MIRT737718	hsa-miR-4667-3p	CLIP-seq
MIRT737717	hsa-miR-766	CLIP-seq
MIRT2251922	hsa-miR-154	CLIP-seq
MIRT2251923	hsa-miR-3126-3p	CLIP-seq
MIRT2251924	hsa-miR-3150a-3p	CLIP-seq
MIRT2251925	hsa-miR-3175	CLIP-seq
MIRT2251926	hsa-miR-342-5p	CLIP-seq
MIRT2251927	hsa-miR-4651	CLIP-seq
MIRT2251928	hsa-miR-4664-5p	CLIP-seq
MIRT1081133	hsa-miR-4667-5p	CLIP-seq
MIRT1081134	hsa-miR-4700-5p	CLIP-seq
MIRT2251929	hsa-miR-491-5p	CLIP-seq
MIRT2251930	hsa-miR-608	CLIP-seq
MIRT1081137	hsa-miR-637	CLIP-seq
MIRT2251931	hsa-miR-939	CLIP-seq
MIRT2251922	hsa-miR-154	CLIP-seq
MIRT2251923	hsa-miR-3126-3p	CLIP-seq
MIRT2251924	hsa-miR-3150a-3p	CLIP-seq
MIRT2251925	hsa-miR-3175	CLIP-seq
MIRT2251926	hsa-miR-342-5p	CLIP-seq
MIRT2251927	hsa-miR-4651	CLIP-seq
MIRT2251928	hsa-miR-4664-5p	CLIP-seq
MIRT1081133	hsa-miR-4667-5p	CLIP-seq
MIRT1081134	hsa-miR-4700-5p	CLIP-seq
MIRT2251929	hsa-miR-491-5p	CLIP-seq
MIRT2251930	hsa-miR-608	CLIP-seq
MIRT1081137	hsa-miR-637	CLIP-seq
MIRT2251931	hsa-miR-939	CLIP-seq
MIRT2683207	hsa-miR-4290	CLIP-seq
MIRT2683208	hsa-miR-4639-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IDA	14980201
GO:0005250	Function	A-type (transient outward) potassium channel activity	IDA	21349352
GO:0005267	Function	Potassium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	11287421
GO:0005513	Process	Detection of calcium ion	TAS	10676964
GO:0005515	Function	Protein binding	IPI	10551270, 11287421, 14623880, 14980201, 14980207, 15358149, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	11287421
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	11287421
GO:0006936	Process	Muscle contraction	IDA	11287421
GO:0006936	Process	Muscle contraction	NAS	11287421
GO:0007165	Process	Signal transduction	TAS	10676964
GO:0007268	Process	Chemical synaptic transmission	NAS	11287421
GO:0007268	Process	Chemical synaptic transmission	TAS	10676964
GO:0008016	Process	Regulation of heart contraction	NAS	11747815
GO:0008016	Process	Regulation of heart contraction	TAS	11287421
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	21493962
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	NAS	11287421
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	26016905
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	21493962
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0015459	Function	Potassium channel regulator activity	TAS	26016905
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042802	Function	Identical protein binding	IPI	15358149
GO:0044325	Function	Transmembrane transporter binding	IPI	21493962
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045163	Process	Clustering of voltage-gated potassium channels	IDA	11287421
GO:0045163	Process	Clustering of voltage-gated potassium channels	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046923	Function	ER retention sequence binding	NAS	11287421
GO:0060306	Process	Regulation of membrane repolarization	IDA	21493962
GO:0071193	Component	Kv4.2-KChIP2 channel complex	IPI	14980201
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0086009	Process	Membrane repolarization	IDA	14980201
GO:0086013	Process	Membrane repolarization during cardiac muscle cell action potential	TAS	26016905
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	21493962
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS
GO:1903764	Process	Regulation of potassium ion export across plasma membrane	IDA	21493962
GO:1903764	Process	Regulation of potassium ion export across plasma membrane	TAS	26016905
GO:1903766	Process	Positive regulation of potassium ion export across plasma membrane	IDA	21349352

Other IDs

• MIM: 604661
• HGNC: 15522
• e!Ensembl: ENSG00000120049

Protein

• UniProt ID: Q9NS61
• Protein name: A-type potassium channel modulatory protein KCNIP2 (Cardiac voltage-gated potassium channel modulatory subunit) (Kv channel-interacting protein 2) (KChIP2) (Potassium channel-interacting protein 2)
• Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels (PubMed:10676964, PubMed:11287421, PubMed:11684073, PubMed:12297301, PubMed:14623880, PubMed:34997220). Modulates channel density, inactivation
• PDB: 7UKH , 7W6S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13202	EF-hand_5	229 → 253	EF hand	Domain
  PF13499	EF-hand_7	178 → 254	EF-hand domain pair	Domain
  PF13833	EF-hand_8	119 → 171	EF-hand domain pair	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart. {ECO:000026
• Sequence:

  MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAA
  PASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPS
  GIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDR
  LNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNK
  DGVVTIEEFIESCQKDENIMRSMQLFDNVI

• Sequence length: 270

Pathways

Reactome Pathway:

Phase 1 - inactivation of fast Na+ channels

Related Genes

No strongly related genes found yet for KCNIP2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KCNIP2.