KAZALD1 (Kazal type serine peptidase inhibitor domain 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 81621
• Gene name: Kazal type serine peptidase inhibitor domain 1
• Gene symbol: KAZALD1
• Synonyms (NCBI Gene): BONO1, FKSG28, FKSG40, IGFBP-rP10
• Chromosome: 10
• Chromosome location: 10q24.31
• Summary: This gene encodes a secreted member of the insulin growth factor-binding protein (IGFBP) superfamily. The protein contains an insulin growth factor-binding domain in its N-terminal region, a Kazal-type serine protease inhibitor and follistatin-like domain

miRNA Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT722380	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT722379	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722378	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT722377	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT722380	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT722379	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT722378	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT722377	hsa-miR-24-3p	HITS-CLIP	19536157
MIRT1079234	hsa-miR-1280	CLIP-seq
MIRT1079235	hsa-miR-129-3p	CLIP-seq
MIRT1079236	hsa-miR-146b-3p	CLIP-seq
MIRT1079237	hsa-miR-1914	CLIP-seq
MIRT1079238	hsa-miR-1976	CLIP-seq
MIRT1079239	hsa-miR-2355-3p	CLIP-seq
MIRT1079240	hsa-miR-296-5p	CLIP-seq
MIRT1079241	hsa-miR-3135	CLIP-seq
MIRT1079242	hsa-miR-323b-3p	CLIP-seq
MIRT1079243	hsa-miR-3614-3p	CLIP-seq
MIRT1079244	hsa-miR-3663-5p	CLIP-seq
MIRT1079245	hsa-miR-4646-3p	CLIP-seq
MIRT1079246	hsa-miR-4687-5p	CLIP-seq
MIRT1079247	hsa-miR-4711-5p	CLIP-seq
MIRT1079248	hsa-miR-4797-5p	CLIP-seq
MIRT1079249	hsa-miR-621	CLIP-seq
MIRT1079250	hsa-miR-759	CLIP-seq
MIRT1079234	hsa-miR-1280	CLIP-seq
MIRT1079240	hsa-miR-296-5p	CLIP-seq
MIRT2019727	hsa-miR-3127-3p	CLIP-seq
MIRT2019728	hsa-miR-3162-3p	CLIP-seq
MIRT2019729	hsa-miR-3179	CLIP-seq
MIRT1079244	hsa-miR-3663-5p	CLIP-seq
MIRT2019730	hsa-miR-4287	CLIP-seq
MIRT2019731	hsa-miR-4469	CLIP-seq
MIRT2019732	hsa-miR-4475	CLIP-seq
MIRT2019733	hsa-miR-4685-3p	CLIP-seq
MIRT2019734	hsa-miR-4725-5p	CLIP-seq
MIRT2019735	hsa-miR-4768-5p	CLIP-seq
MIRT2019736	hsa-miR-504	CLIP-seq
MIRT2019737	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005520	Function	Insulin-like growth factor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005614	Component	Interstitial matrix	IBA
GO:0005614	Component	Interstitial matrix	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IEA

Other IDs

• MIM: 609208
• HGNC: 25460
• e!Ensembl: ENSG00000107821

Protein

• UniProt ID: Q96I82
• Protein name: Kazal-type serine protease inhibitor domain-containing protein 1
• Protein function: Involved in the proliferation of osteoblasts during bone formation and bone regeneration. Promotes matrix assembly (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00219	IGFBP	53 → 108	Insulin-like growth factor binding protein	Domain
  PF07648	Kazal_2	122 → 168	Kazal-type serine protease inhibitor domain	Domain
  PF07679	I-set	172 → 270	Immunoglobulin I-set domain	Domain

• Sequence:

  MLPPPRPAAALALPVLLLLLVVLTPPPTGARPSPGPDYLRRGWMRLLAEGEGCAPCRPEE
  CAAPRGCLAGRVRDACGCCWECANLEGQLCDLDPSAHFYGHCGEQLECRLDTGGDLSRGE
  VPEPLCACRSQSPLCGSDGHTYSQICRLQEAARARPDANLTVAHPGPCESGPQIVSHPYD
  TWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQI
  QAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEEEAESEEN
  DDYY

• Sequence length: 304

Related Genes

No strongly related genes found yet for KAZALD1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KAZALD1.