KATNBL1 (katanin regulatory subunit B1 like 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79768
• Gene name: Katanin regulatory subunit B1 like 1
• Gene symbol: KATNBL1
• Synonyms (NCBI Gene): C15orf29
• Chromosome: 15
• Chromosome location: 15q14

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048432	hsa-miR-100-5p	CLASH	23622248
MIRT437595	hsa-miR-140-5p	Microarray, qRT-PCR	22815788

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 26496610, 26929214, 28514442, 30886144, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	26929214
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008352	Component	Katanin complex	IPI	26929214
GO:0008352	Component	Katanin complex	ISS
GO:0015630	Component	Microtubule cytoskeleton	NAS	28436967
GO:0030496	Component	Midbody	IDA
GO:0031122	Process	Cytoplasmic microtubule organization	IDA	26929214
GO:0031122	Process	Cytoplasmic microtubule organization	NAS	28436967
GO:0032154	Component	Cleavage furrow	IDA
GO:0051495	Process	Positive regulation of cytoskeleton organization	IDA	26929214
GO:0072686	Component	Mitotic spindle	IDA
GO:0097431	Component	Mitotic spindle pole	IDA	26929214

Other IDs

• MIM: 616235
• HGNC: 26199
• e!Ensembl: ENSG00000134152

Protein

• UniProt ID: Q9H079
• Protein name: KATNB1-like protein 1 (Katanin p80 subunit B-like 1)
• Protein function: Regulates microtubule-severing activity of KATNAL1 in a concentration-dependent manner in vitro.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13925	Katanin_con80	149 → 300	con80 domain of Katanin	Domain

• Sequence:

  MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVK
  SPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRT
  YLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISEL
  VAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLN
  WLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYL
  LQLH

• Sequence length: 304

Related Genes

No strongly related genes found yet for KATNBL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to KATNBL1.