JPT1 (Jupiter microtubule associated homolog 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 51155
Gene name Jupiter microtubule associated homolog 1
Gene symbol JPT1
Synonyms (NCBI Gene)
ARM2HN1HN1A
Chromosome 17
Chromosome location 17q25.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619242 14569 ENSG00000189159
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UK76
Protein name Jupiter microtubule associated homolog 1 (Androgen-regulated protein 2) (Hematological and neurological expressed 1 protein) [Cleaved into: Jupiter microtubule associated homolog 1, N-terminally processed]
Protein function Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the functio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17054 JUPITER 1 → 71 Microtubule-Associated protein Jupiter Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis, skeletal muscle, thymus, prostate, colon, peripheral blood cells, brain and placenta. {ECO:0000269|PubMed:15094197}.
Sequence 
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQA
SWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSE
EKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
Sequence length 154
Interactions View interactions

No strongly related genes found yet for JPT1.

No additional diseases found yet through genes similar to JPT1.