JMJD7 (jumonji domain containing 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 100137047
• Gene name: Jumonji domain containing 7
• Gene symbol: JMJD7
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: This gene encodes a highly conserved protein with a JmjC domain, which are part of the cupin metalloenzyme superfamily. JmjC proteins may function as 2-oxoglutarate-Fe(II)-dependent dioxygenases. Most tissues also express read-through transcripts from thi

miRNA Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1077081	hsa-miR-1197	CLIP-seq
MIRT1077082	hsa-miR-139-3p	CLIP-seq
MIRT1077083	hsa-miR-365	CLIP-seq
MIRT1077084	hsa-miR-3660	CLIP-seq
MIRT1077085	hsa-miR-3675-3p	CLIP-seq
MIRT1077086	hsa-miR-4436a	CLIP-seq
MIRT1077087	hsa-miR-4526	CLIP-seq
MIRT1077088	hsa-miR-4700-3p	CLIP-seq
MIRT1077089	hsa-miR-4740-3p	CLIP-seq
MIRT1077090	hsa-miR-4753-3p	CLIP-seq
MIRT1077091	hsa-miR-4795-3p	CLIP-seq
MIRT2251062	hsa-miR-627	CLIP-seq
MIRT2554573	hsa-miR-1287	CLIP-seq
MIRT2554574	hsa-miR-3135b	CLIP-seq
MIRT2554575	hsa-miR-320a	CLIP-seq
MIRT2554576	hsa-miR-320b	CLIP-seq
MIRT2554577	hsa-miR-320c	CLIP-seq
MIRT2554578	hsa-miR-320d	CLIP-seq
MIRT2554579	hsa-miR-338-3p	CLIP-seq
MIRT2554580	hsa-miR-4429	CLIP-seq
MIRT2554581	hsa-miR-4530	CLIP-seq
MIRT2554582	hsa-miR-4532	CLIP-seq
MIRT2554583	hsa-miR-4640-5p	CLIP-seq
MIRT2554584	hsa-miR-4691-5p	CLIP-seq
MIRT2554585	hsa-miR-4695-3p	CLIP-seq
MIRT2554586	hsa-miR-4726-5p	CLIP-seq
MIRT2554587	hsa-miR-513c	CLIP-seq
MIRT2554588	hsa-miR-514b-5p	CLIP-seq
MIRT2251062	hsa-miR-627	CLIP-seq
MIRT2554589	hsa-miR-711	CLIP-seq
MIRT2554584	hsa-miR-4691-5p	CLIP-seq
MIRT2251062	hsa-miR-627	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004175	Function	Endopeptidase activity	IDA	28847961
GO:0004177	Function	Aminopeptidase activity	IDA	28847961
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004497	Function	Monooxygenase activity	IDA	29915238
GO:0004497	Function	Monooxygenase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 29915238, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	29915238
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29915238
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0018126	Process	Protein hydroxylation	IDA	29915238
GO:0046872	Function	Metal ion binding	IEA
GO:0106155	Function	Peptidyl-lysine 3-dioxygenase activity	EXP	29915238
GO:0106155	Function	Peptidyl-lysine 3-dioxygenase activity	IDA	29915238, 35410347
GO:0106155	Function	Peptidyl-lysine 3-dioxygenase activity	IEA

Other IDs

• MIM: 621306
• HGNC: 34397
• e!Ensembl: ENSG00000243789

Protein

• UniProt ID: P0C870
• Protein name: Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 (EC 1.14.11.63) (EC 3.4.-.-) (JmjC domain-containing protein 7) (Jumonji domain-containing protein 7) (L-lysine (3S)-hydroxylase JMJD7)
• Protein function: Bifunctional enzyme that acts both as an endopeptidase and 2-oxoglutarate-dependent monooxygenase (PubMed:28847961, PubMed:29915238). Endopeptidase that cleaves histones N-terminal tails at the carboxyl side of methylated arginine or lysine resi
• PDB: 5NFN , 5NFO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13621	Cupin_8	38 → 298	Cupin-like domain	Domain

• Sequence:

  MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
  WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA
  QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
  HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPL
  DPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWYDMEYDLKY
  SYFQLLDSLTKASGLD

• Sequence length: 316

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
JMJD7-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	28847961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28847961		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	36518097	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28030848	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for JMJD7.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to JMJD7.