JCHAIN (joining chain of multimeric IgA and IgM)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3512
• Gene name: Joining chain of multimeric IgA and IgM
• Gene symbol: JCHAIN
• Synonyms (NCBI Gene): IGCJ, IGJ, JCH
• Chromosome: 4
• Chromosome location: 4q13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020790	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020790	hsa-miR-155-5p	HITS-CLIP	22473208

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Unknown	8406004

Gene ontology (GO) Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IDA	21786026
GO:0003094	Process	Glomerular filtration	IMP	23398317
GO:0003697	Function	Single-stranded DNA binding	IDA	21786026
GO:0003823	Function	Antigen binding	NAS	2984306
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	2984306, 14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	23398317
GO:0006955	Process	Immune response	NAS	2984306
GO:0006959	Process	Humoral immune response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	23250751
GO:0019862	Function	IgA binding	IEA
GO:0019862	Function	IgA binding	IMP	17237408
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031210	Function	Phosphatidylcholine binding	IDA	21786026
GO:0034987	Function	Immunoglobulin receptor binding	IBA
GO:0034987	Function	Immunoglobulin receptor binding	IDA	23250751
GO:0034987	Function	Immunoglobulin receptor binding	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IMP	17237408
GO:0042803	Function	Protein homodimerization activity	IDA	21786026
GO:0042834	Function	Peptidoglycan binding	IDA	21786026
GO:0045087	Process	Innate immune response	IDA	21786026
GO:0060267	Process	Positive regulation of respiratory burst	IDA	24145934
GO:0065003	Process	Protein-containing complex assembly	IMP	17237408
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IDA	23250751
GO:0071750	Component	Dimeric IgA immunoglobulin complex	IEA
GO:0071750	Component	Dimeric IgA immunoglobulin complex	IMP	17237408
GO:0071751	Component	Secretory IgA immunoglobulin complex	IDA	23250751, 24145934, 32029686
GO:0071752	Component	Secretory dimeric IgA immunoglobulin complex	IDA	24145934
GO:0071756	Component	Pentameric IgM immunoglobulin complex	IBA
GO:0071756	Component	Pentameric IgM immunoglobulin complex	IDA	21786026, 23250751, 24145934, 32029689, 36949194, 37095205
GO:0071757	Component	Hexameric IgM immunoglobulin complex	IDA	21786026
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 147790
• HGNC: 5713
• e!Ensembl: ENSG00000132465

Protein

• UniProt ID: P01591
• Protein name: Immunoglobulin J chain (Joining chain of multimeric IgA and IgM)
• Protein function: Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces dimers and/or larger polymers. It also helps to bind these immunoglo
• PDB: 6KXS , 6LX3 , 6LXW , 6UE7 , 6UE8 , 6UE9 , 6UEA , 7K0C , 7Y09 , 7Y0H , 7Y0J , 7YG2 , 7YSG , 7YTC , 7YTD , 8ADY , 8ADZ , 8AE0 , 8AE2 , 8AE3 , 8BPE , 8BPF , 8GZN , 8R83 , 8R84 , 8SKU , 8SKV , 8WYR , 8WYS , 9ARV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15097	Ig_J_chain	24 → 159	Immunoglobulin J chain	Family

• Sequence:

  MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNI
  RIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSAT
  ETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD

• Sequence length: 159

Pathways

Reactome Pathway

Cell surface interactions at the vascular wall

Scavenging of heme from plasma

Related Genes

No strongly related genes found yet for JCHAIN.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to JCHAIN.