ITGAM (integrin subunit alpha M)

Gene

• Entrez ID: 3684
• Gene name: Integrin subunit alpha M
• Gene symbol: ITGAM
• Synonyms (NCBI Gene): CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1073816	hsa-miR-203	CLIP-seq
MIRT1073817	hsa-miR-224	CLIP-seq
MIRT1073818	hsa-miR-23a	CLIP-seq
MIRT1073819	hsa-miR-23b	CLIP-seq
MIRT1073820	hsa-miR-23c	CLIP-seq
MIRT1073821	hsa-miR-338-3p	CLIP-seq
MIRT1073822	hsa-miR-4488	CLIP-seq
MIRT1073823	hsa-miR-4489	CLIP-seq
MIRT1073824	hsa-miR-4530	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT1073826	hsa-miR-4697-5p	CLIP-seq
MIRT1073827	hsa-miR-517b	CLIP-seq
MIRT1073828	hsa-miR-603	CLIP-seq
MIRT1073829	hsa-miR-637	CLIP-seq
MIRT1073830	hsa-miR-661	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT1073828	hsa-miR-603	CLIP-seq
MIRT2250108	hsa-miR-342-3p	CLIP-seq
MIRT2250109	hsa-miR-3650	CLIP-seq
MIRT2250110	hsa-miR-377	CLIP-seq
MIRT1073825	hsa-miR-4643	CLIP-seq
MIRT2250111	hsa-miR-4717-3p	CLIP-seq
MIRT2250112	hsa-miR-4802-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Activation	15163413;8095266;9295016

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IC
GO:0001774	Process	Microglial cell activation	ISS
GO:0001851	Function	Complement component C3b binding	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002430	Process	Complement receptor mediated signaling pathway	ISS
GO:0002931	Process	Response to ischemia	IEA
GO:0005178	Function	Integrin binding	NAS	20199584
GO:0005515	Function	Protein binding	IPI	12208882, 15004192, 15194813, 16246332, 21193407, 28939773, 32296183, 38730209
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005886	Component	Plasma membrane	IDA	28807980
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2563162
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IDA	18083624
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	18083624
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	2563162
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0009897	Component	External side of plasma membrane	NAS	20199584
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	19234460
GO:0009986	Component	Cell surface	IEA
GO:0010668	Process	Ectodermal cell differentiation	IEP	23154389
GO:0016020	Component	Membrane	IEA
GO:0030900	Process	Forebrain development	ISS
GO:0031072	Function	Heat shock protein binding	IPI	12496435
GO:0032355	Process	Response to estradiol	IEA
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	21193407
GO:0032930	Process	Positive regulation of superoxide anion generation	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0034688	Component	Integrin alphaM-beta2 complex	IBA
GO:0034688	Component	Integrin alphaM-beta2 complex	IPI	18083624
GO:0034688	Component	Integrin alphaM-beta2 complex	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038024	Function	Cargo receptor activity	ISS
GO:0038024	Function	Cargo receptor activity	ISS
GO:0043315	Process	Positive regulation of neutrophil degranulation	IGI	21193407
GO:0044853	Component	Plasma membrane raft	IDA	21193407
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045963	Process	Negative regulation of dopamine metabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070821	Component	Tertiary granule membrane	IEA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097242	Process	Amyloid-beta clearance	ISS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	NAS	20199584
GO:0140459	Process	Response to Gram-positive bacterium	IEA
GO:0150062	Process	Complement-mediated synapse pruning	ISS
GO:0150064	Process	Vertebrate eye-specific patterning	ISS
GO:1904151	Process	Positive regulation of microglial cell mediated cytotoxicity	ISS
GO:1904643	Process	Response to curcumin	IEA

Other IDs

• MIM: 120980
• HGNC: 6149
• e!Ensembl: ENSG00000169896

Protein

• UniProt ID: P11215
• Protein name: Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)
• Protein function: Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens (PubMed:20008295, PubMed:9558116). It is identical wit
• PDB: 1BHO, 1BHQ, 1IDN, 1IDO, 1JLM, 1M1U, 1MF7, 1N9Z, 1NA5, 2LKE, 2LKJ, 3Q3G, 3QA3, 4M76, 4XW2, 6RHW, 7AKK, 7P2D, 7USL, 7USM, 8CE6, 8CE9, 8VOH, 8VOI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00092	VWA	150 → 327	von Willebrand factor type A domain	Domain
  PF01839	FG-GAP	520 → 555	FG-GAP repeat	Repeat
  PF08441	Integrin_alpha2	614 → 1005	Integrin alpha	Family
  PF00357	Integrin_alpha	1129 → 1143	Integrin alpha cytoplasmic region	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in monocytes and granulocytes (PubMed:1346576). Expressed in neutrophils (at protein level) (PubMed:21193407). {ECO:0000269|PubMed:1346576, ECO:0000269|PubMed:21193407}.
• Sequence:

  MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
  GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
  GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
  KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
  ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
  NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
  SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
  LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
  HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
  GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
  LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
  TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
  CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
  SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
  RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
  VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
  GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
  NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
  LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
  MSEGGPPGAEPQ

• Sequence length: 1152

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOIMMUNE DISORDER OF MUSCULOSKELETAL SYSTEM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ITGAM-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	27460017		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	7687860		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	25361478		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29852400		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	9052378		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11007035, 12109853, 15770638, 19747912, 25481858, 28984423, 30315692, 7815843		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	16764927		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	24782118		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30844038		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	3298610, 7775666		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23134465, 40465637	Associate	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29738851		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24193664		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35328793	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11001897, 15164377, 21173096, 30630982	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	9290560	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12025897, 7594025	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24373176		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	33103514	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	25993293	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29853563		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	28097522		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21998326		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20666624, 21379322, 23708937, 24730590, 25619457, 28387942		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22251373	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	24100919	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10193433, 10873967, 22251373, 31774828, 33123735, 35842449, 7621589	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1575573, 8536370, 8870692	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16600024, 37371101	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22909167, 27183585, 30816463		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23880611, 25420684, 33602227, 37240226, 7596088	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	35782055	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19800635, 34925641, 35104001	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21998326		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28073885		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32389013	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	19747912		★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	30571465		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	23134465		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20666624, 21840425, 26683153, 27118513, 28191643, 28263189, 28407558, 28857285, 29158419, 29908907, 30353919		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23386618, 27118513, 29908907, 7909242	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15545055, 37003592	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	16237110	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28377641, 29052524		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19488045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19488045		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	28809856, 31767892	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21315786, 28418913		★☆☆☆☆ Found in Text Mining only
Blau syndrome	Blau syndrome	Pubtator	36192768	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	15850829	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	2049307	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	20082712, 35819574	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25059678		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12460925, 19127252, 25294811		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24489661	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	29733693	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	19497921	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Sequestration	Bronchopulmonary Disease	BEFREE	10329106		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27868136		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	34635743	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37239465	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35782055	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30689427		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27321064	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33860040	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28418913		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23565296, 26756887		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31950034, 36793506, 36854280	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22718118	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35793873	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30689427		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26563750, 29329880		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28971642		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767, 36316672	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	29436628	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	29621339		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	30998704	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	23134465	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28855861		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31355307	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38637126	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28288898, 28735520		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	30662439	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30177688		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	30949182	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	21045076, 28992140, 30280599, 30717079		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8102560		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	11953106		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20438701, 26422753, 30633902, 9817722		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28642299		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30897363		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35026420	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23636052, 31063937		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17602351, 39286250, 39891110	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21921589	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25294811, 30562962		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23722542		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23722542		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25638150	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	25678086		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	25678086	Associate	★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	9436919		★☆☆☆☆ Found in Text Mining only
Congenital leukocyte adherence deficiency	Congenital Leukocyte Adherence Deficiency	BEFREE	1590804, 1968909, 20859258, 7705401, 7901025, 8697667, 8826696, 8938844		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23573259		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12717693, 17286760, 20628522	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	18460014	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23573259		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23573259, 37933872, 39614436, 8613609	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23573259		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	12717693	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	15464320	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	22461003	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	14571275		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17602351	Associate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	21814168		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10853863, 25769931, 36248793	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	24098711	Inhibit	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	16037628		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27635406		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34706460	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	17184966, 25341795		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22710427	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	16033404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	22574929		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14623906, 17911589, 29534207		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14623906, 17911589, 29534207		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32117292, 36066992	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	1673028, 27306948	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15635816	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23686079	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15277376, 1673028, 20483667, 22355341, 30753130		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24018334, 26525587, 30356719		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	18496641		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34735495	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27815317		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32117292, 36766809, 37773794	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29190915		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse panbronchiolitis	Pubtator	9030883	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9758448		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25361478, 30390640		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319, 30390640	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28241321		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22574929		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	24402571		★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30314882, 30375700, 30431056		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	26422753		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	29424023		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa	Epidermolysis bullosa	Pubtator	28736230	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Frontal Lobe	Frontal lobe epilepsy	Pubtator	34706460	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Generalized	Generalized epilepsy	Pubtator	40495522	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26563750, 29329880		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	19939855, 21151989, 21719445	Associate	★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	30844038		★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	8568312	Inhibit	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30936549		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30508092		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22544759, 26018806		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21965647		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	7775666		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30439502		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21705618	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29062041, 31529407		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27271009, 29062041, 31529407		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22752645	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28219886, 30712924		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30042224, 37685869	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	30844038		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	19939855	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26442657		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	9758448		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	9158103	Associate	★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	29930006		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	22552879, 27460017		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25093488	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34635743	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	40079309	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	21379322		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	16867159	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	26608915		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemias	Hyperlipidemia	Pubtator	27882430	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27882430	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26516175		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21309737	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31227791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ileitis	Ileitis	CTD_human_DG	10647630		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	1968909		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30737131, 30897363		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17602351, 33259599	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31063937, 31275059		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25341795		★☆☆☆☆ Found in Text Mining only
Intermittent Claudication	Claudication	Pubtator	9787299	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33764282	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	36293070	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	26526388		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28236118		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28506643		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19939855, 21379322		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19939855, 21719445	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	17136029	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29068910		★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	33391182	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12515728, 25316678, 28405496, 30150435, 30675257		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1378322, 16550517, 20228269, 3261183, 33301193, 7513207, 8556956	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	8556956	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	11071654	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10354136, 12717686, 16550517, 25978433, 26065685, 27074819, 28646564, 32780544, 34148032, 9488612	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35406726	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30334354	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	25239423, 33301193, 9734655	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19036083, 22349414, 23092917, 24480914, 24782118, 25005557, 27102414, 27400753, 30002127, 3261183		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	30334354		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	11703376, 1968909		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	23867183	Associate	★☆☆☆☆ Found in Text Mining only
Leukocyte Disorders	Leukocyte disorders	Pubtator	15862420, 32941618	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	11721441, 29296812		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	18204446, 18204448		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27321064		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17036394, 33860040	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28642299		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22727562	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33860040	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	22837127	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22837127		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36941690	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28805019		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24189400	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	20848568, 21719445, 21792837, 21952918, 22586164, 22933624, 28263189, 30498196		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	19939855, 21151989	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17083624, 22110167, 27847409, 39776899	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18204098, 18204446, 19129174, 19286673, 19387459, 19442287, 19939855, 19997561, 20848568, 21151989, 21408207, 21719445, 21792837, 23386618, 23918739, 24608226, 26606652, 27118513, 29207897, 29908907, 31659207, 31774828, 37239465, 7515335	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	20848568, 21719445, 21792837, 21952918, 22586164, 22933624, 28263189, 30498196		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18204098, 18204448, 19129174, 19286673, 19387459, 19939855, 19997561, 20629846, 20666624, 20848568, 20947545, 21151989, 21362770, 21408207, 21454473, 21719445, 21792837, 21840425, 21952918, 22523428, 22586164, 22933624, 23708937, 23753600, 23918739, 24269694, 24608226, 24886912, 25315704, 26094774, 26683153, 27118513, 27974454, 28263189, 28407558, 28464513, 29207897, 29600248, 30041578, 30498196, 31774828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18204446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204446, 19286673, 21408207, 24871463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	18204446, 19838195, 21408207, 23740937, 24871463, 26502338, 26606652, 27399966, 28714469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	18204446, 18204448		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	19286673, 23917156, 23943494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Meningoencephalitis	Lupus Meningoencephalitis	CTD_human_DG	26773105		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24386384, 29207897	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	25315704, 29207897, 29600248, 30540578, 30672908, 30712924		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vasculitis, Central Nervous System	Central nervous system lupus	CTD_human_DG	26773105		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	20848568, 21719445, 21792837, 21952918, 22586164, 22933624, 28263189, 30498196		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24120241	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	15466379		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	8556956		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27144517, 29898964, 8668164, 9162223		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34166375	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	26497849		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23372669, 25957418, 27144517		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	2049307	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28231837	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25294811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26756887		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29329880		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10404069, 27402485, 31270275		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24072746, 29776955		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29953504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28418913		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19494278, 22698406, 23341539, 26563750, 28504320, 30568188, 31534525, 31719821		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25294811		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	34635743	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	21151989	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12485936		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22189006		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37562584	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37236195	Associate	★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	26516175		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	17286760	Stimulate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24659162, 37933872	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	23748415		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	7490317	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10877455, 33795012, 9883968	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21362770, 25697397, 31466733		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29296812		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33577137, 35088567	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	11893077		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12591277		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10551687, 35864510, 37246754	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24786973, 29232411, 29746525		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	32389013	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	24402571, 24573249		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	29306235	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12480707, 15827159, 1647137, 17671218, 19572148, 20675595, 21228116, 21233403, 21389319, 21519029, 21969559, 22054049, 22143793, 22698406, 22735808, 22770218, 22914051, 22952847, 22952881, 23184679, 23219012, 23241958, 23266888, 23345334, 23722542, 24072746, 24520174, 24651438, 24848257, 25051201, 25156255, 25294811, 25825443, 26098895, 26296362, 26526388, 26756887, 27271009, 28504320, 29016864, 29158842, 29255466, 29356965, 29467880, 29492204, 29690614, 29721383, 29776955, 29956798, 30458852, 30568188, 30619287, 31322193, 31404549, 31529407, 8031851, 9568072		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	19286673, 29207897		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29738851		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	CTD_human_DG	26773105		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31719821		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	1762294, 33259599, 9507227	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29296812		★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	33259599	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	21688797		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26608915		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19572148		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29035695	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	29776955, 30356719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	32928872, 36680274	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35818731, 36921085	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Morbid	Obesity	Pubtator	37266430	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	21719445		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35743247, 37239465	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36216277	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10849374, 34588497	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30508092		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	11390487		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29329880		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21972293, 25658637, 35186171, 37644468	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	12121227, 29293541, 30322390		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10404069, 27402485, 31270275		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24741628	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	21343291, 25214403		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	30894427	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12359173, 28276259		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35026420	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	22698406		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	27868136	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26932498, 27181102, 30143044, 9402503		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	30143044	Stimulate	★☆☆☆☆ Found in Text Mining only
Platelet alpha-Granule Deficiency	Platelet Alpha-Granule Deficiency	BEFREE	29930006		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	18625913		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	14717780	Associate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	31353826		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20228269		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28405496		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24072746, 29776955		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22470535, 24072746, 25156255		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	12121227, 29293541, 30322390		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17637826, 31211819		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38301504	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11359957, 25420684, 9577287	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23635004	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23834268	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	25465103		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	18775487		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	7911707		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	28873200		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	18775487		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	17284607	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Retinoschisis	Pubtator	33601057	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24848257		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19604442, 25315704, 28387942, 30704942, 31774828		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22609476		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	7586698	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19036083, 23757729, 24848257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23566496		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Diffuse	Scleroderma	Pubtator	39273179	Inhibit	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	33104706	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	23386618	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11390487, 24576991, 28006751, 28675904, 28714582, 29343555, 30291379, 31048432, 31644352		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	21951393	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	37529039	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12413770		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	38172514	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	8652825	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22718118		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25238263		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26193368, 31744214, 35514301	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27798955, 29215754		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29024334		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	23573259		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29182639		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27708340		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23787075, 24120241, 32415175	Associate	★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	21362770, 21840425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASDB_DG	23740937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	23740937		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	17577920	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	22059534, 24277659		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	33259599	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	14530377	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29953504		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29953504		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	26756227, 29953504	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	7821111		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	26563750		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	19369244	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	9067526	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	21151989, 35747245	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	10550182	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	15862420	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	15678279	Inhibit	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	1708944		★☆☆☆☆ Found in Text Mining only