IRS2 (insulin receptor substrate 2)

Gene

• Entrez ID: 8660
• Gene name: Insulin receptor substrate 2
• Gene symbol: IRS2
• Synonyms (NCBI Gene): IRS-2
• Chromosome: 13
• Chromosome location: 13q34
• Summary: This gene encodes the insulin receptor substrate 2, a cytoplasmic signaling molecule that mediates effects of insulin, insulin-like growth factor 1, and other cytokines by acting as a molecular adaptor between diverse receptor tyrosine kinases and downstr

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1805097	C>G,T	Risk-factor	Coding sequence variant, missense variant
rs137852740	G>A,C	Risk-factor	Missense variant, synonymous variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003808	hsa-miR-7-5p	Reporter assay, Western blot	18483236
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT006332	hsa-miR-145-5p	Luciferase reporter assay	22431718
MIRT007355	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT007355	hsa-miR-33a-5p	Immunofluorescence, Luciferase reporter assay, Western blot	23547260
MIRT016052	hsa-miR-374b-5p	Sequencing	20371350
MIRT003808	hsa-miR-7-5p	Reporter assay;Western blot	18483236
MIRT027863	hsa-miR-98-5p	Microarray	19088304
MIRT052219	hsa-let-7b-5p	CLASH	23622248
MIRT051561	hsa-let-7e-5p	CLASH	23622248
MIRT041990	hsa-miR-484	CLASH	23622248
MIRT437827	hsa-miR-135a-5p	Luciferase reporter assay	23579070
MIRT437827	hsa-miR-135a-5p	Luciferase reporter assay	23579070
MIRT437827	hsa-miR-135a-5p	Luciferase reporter assay	23579070
MIRT437827	hsa-miR-135a-5p	Luciferase reporter assay	23579070
MIRT052219	hsa-let-7b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24810113
MIRT052219	hsa-let-7b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24810113
MIRT052219	hsa-let-7b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24810113
MIRT052219	hsa-let-7b-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24810113
MIRT248936	hsa-miR-4501	HITS-CLIP	23313552
MIRT702681	hsa-miR-4793-5p	HITS-CLIP	23313552
MIRT702680	hsa-miR-3607-5p	HITS-CLIP	23313552
MIRT702679	hsa-miR-146a-3p	HITS-CLIP	23313552
MIRT702678	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT702677	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT702675	hsa-miR-3921	HITS-CLIP	23313552
MIRT702676	hsa-miR-4653-5p	HITS-CLIP	23313552
MIRT702674	hsa-miR-6730-3p	HITS-CLIP	23313552
MIRT702673	hsa-miR-3660	HITS-CLIP	23313552
MIRT702672	hsa-miR-4526	HITS-CLIP	23313552
MIRT702671	hsa-miR-6719-3p	HITS-CLIP	23313552
MIRT702670	hsa-miR-4299	HITS-CLIP	23313552
MIRT702669	hsa-miR-3913-3p	HITS-CLIP	23313552
MIRT702668	hsa-miR-4504	HITS-CLIP	23313552
MIRT702667	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT702666	hsa-miR-489-3p	HITS-CLIP	23313552
MIRT732366	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	28123847
MIRT732366	hsa-miR-338-3p	Luciferase reporter assay, qRT-PCR, Western blot	28123847
MIRT735563	hsa-miR-181d-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	34155619
MIRT051561	hsa-let-7e-5p	qRT-PCR	32710190
MIRT248936	hsa-miR-4501	HITS-CLIP	23313552
MIRT702681	hsa-miR-4793-5p	HITS-CLIP	23313552
MIRT702680	hsa-miR-3607-5p	HITS-CLIP	23313552
MIRT702679	hsa-miR-146a-3p	HITS-CLIP	23313552
MIRT702678	hsa-miR-301a-5p	HITS-CLIP	23313552
MIRT702677	hsa-miR-301b-5p	HITS-CLIP	23313552
MIRT702675	hsa-miR-3921	HITS-CLIP	23313552
MIRT702676	hsa-miR-4653-5p	HITS-CLIP	23313552
MIRT702674	hsa-miR-6730-3p	HITS-CLIP	23313552
MIRT702673	hsa-miR-3660	HITS-CLIP	23313552
MIRT702672	hsa-miR-4526	HITS-CLIP	23313552
MIRT702671	hsa-miR-6719-3p	HITS-CLIP	23313552
MIRT702670	hsa-miR-4299	HITS-CLIP	23313552
MIRT702669	hsa-miR-3913-3p	HITS-CLIP	23313552
MIRT702668	hsa-miR-4504	HITS-CLIP	23313552
MIRT702667	hsa-miR-542-3p	HITS-CLIP	23313552
MIRT702666	hsa-miR-489-3p	HITS-CLIP	23313552
MIRT1072121	hsa-let-7a	CLIP-seq
MIRT1072122	hsa-let-7b	CLIP-seq
MIRT1072123	hsa-let-7c	CLIP-seq
MIRT1072124	hsa-let-7d	CLIP-seq
MIRT1072125	hsa-let-7e	CLIP-seq
MIRT1072126	hsa-let-7f	CLIP-seq
MIRT1072127	hsa-let-7g	CLIP-seq
MIRT1072128	hsa-let-7i	CLIP-seq
MIRT1072129	hsa-miR-103a	CLIP-seq
MIRT1072130	hsa-miR-107	CLIP-seq
MIRT1072131	hsa-miR-1208	CLIP-seq
MIRT1072132	hsa-miR-126	CLIP-seq
MIRT1072133	hsa-miR-141	CLIP-seq
MIRT1072134	hsa-miR-145	CLIP-seq
MIRT1072135	hsa-miR-15a	CLIP-seq
MIRT1072136	hsa-miR-15b	CLIP-seq
MIRT1072137	hsa-miR-16	CLIP-seq
MIRT1072138	hsa-miR-181a	CLIP-seq
MIRT1072139	hsa-miR-181b	CLIP-seq
MIRT1072140	hsa-miR-181c	CLIP-seq
MIRT1072141	hsa-miR-181d	CLIP-seq
MIRT1072142	hsa-miR-188-3p	CLIP-seq
MIRT1072143	hsa-miR-1909	CLIP-seq
MIRT1072144	hsa-miR-1910	CLIP-seq
MIRT1072145	hsa-miR-1914	CLIP-seq
MIRT1072146	hsa-miR-195	CLIP-seq
MIRT1072147	hsa-miR-200a	CLIP-seq
MIRT1072148	hsa-miR-202	CLIP-seq
MIRT1072149	hsa-miR-2052	CLIP-seq
MIRT1072150	hsa-miR-2114	CLIP-seq
MIRT1072151	hsa-miR-223	CLIP-seq
MIRT1072152	hsa-miR-224	CLIP-seq
MIRT1072153	hsa-miR-23a	CLIP-seq
MIRT1072154	hsa-miR-23b	CLIP-seq
MIRT1072155	hsa-miR-23c	CLIP-seq
MIRT1072156	hsa-miR-3065-3p	CLIP-seq
MIRT1072157	hsa-miR-3117-3p	CLIP-seq
MIRT1072158	hsa-miR-3127-5p	CLIP-seq
MIRT1072159	hsa-miR-3143	CLIP-seq
MIRT1072160	hsa-miR-3169	CLIP-seq
MIRT1072161	hsa-miR-3177-5p	CLIP-seq
MIRT1072162	hsa-miR-3190	CLIP-seq
MIRT1072163	hsa-miR-3200-3p	CLIP-seq
MIRT1072164	hsa-miR-330-3p	CLIP-seq
MIRT1072165	hsa-miR-3545-3p	CLIP-seq
MIRT1072166	hsa-miR-3649	CLIP-seq
MIRT1072167	hsa-miR-3659	CLIP-seq
MIRT1072168	hsa-miR-3667-5p	CLIP-seq
MIRT1072169	hsa-miR-369-3p	CLIP-seq
MIRT1072170	hsa-miR-374a	CLIP-seq
MIRT1072171	hsa-miR-374b	CLIP-seq
MIRT1072172	hsa-miR-378g	CLIP-seq
MIRT1072173	hsa-miR-3910	CLIP-seq
MIRT1072174	hsa-miR-3925-3p	CLIP-seq
MIRT1072175	hsa-miR-3973	CLIP-seq
MIRT1072176	hsa-miR-3977	CLIP-seq
MIRT1072177	hsa-miR-409-5p	CLIP-seq
MIRT1072178	hsa-miR-423-3p	CLIP-seq
MIRT1072179	hsa-miR-424	CLIP-seq
MIRT1072180	hsa-miR-4258	CLIP-seq
MIRT1072181	hsa-miR-4262	CLIP-seq
MIRT1072182	hsa-miR-4269	CLIP-seq
MIRT1072183	hsa-miR-4270	CLIP-seq
MIRT1072184	hsa-miR-4272	CLIP-seq
MIRT1072185	hsa-miR-4291	CLIP-seq
MIRT1072186	hsa-miR-431	CLIP-seq
MIRT1072187	hsa-miR-4318	CLIP-seq
MIRT1072188	hsa-miR-4419a	CLIP-seq
MIRT1072189	hsa-miR-4437	CLIP-seq
MIRT1072190	hsa-miR-4441	CLIP-seq
MIRT1072191	hsa-miR-4458	CLIP-seq
MIRT1072192	hsa-miR-4459	CLIP-seq
MIRT1072193	hsa-miR-4461	CLIP-seq
MIRT1072194	hsa-miR-4468	CLIP-seq
MIRT1072195	hsa-miR-4477b	CLIP-seq
MIRT1072196	hsa-miR-4489	CLIP-seq
MIRT1072197	hsa-miR-4500	CLIP-seq
MIRT1072198	hsa-miR-4509	CLIP-seq
MIRT1072199	hsa-miR-4510	CLIP-seq
MIRT1072200	hsa-miR-4514	CLIP-seq
MIRT1072201	hsa-miR-452	CLIP-seq
MIRT1072202	hsa-miR-4530	CLIP-seq
MIRT1072203	hsa-miR-455-3p	CLIP-seq
MIRT1072204	hsa-miR-4648	CLIP-seq
MIRT1072205	hsa-miR-4653-3p	CLIP-seq
MIRT1072206	hsa-miR-4654	CLIP-seq
MIRT1072207	hsa-miR-4658	CLIP-seq
MIRT1072208	hsa-miR-4666-3p	CLIP-seq
MIRT1072209	hsa-miR-4674	CLIP-seq
MIRT1072210	hsa-miR-4676-3p	CLIP-seq
MIRT1072211	hsa-miR-4676-5p	CLIP-seq
MIRT1072212	hsa-miR-4683	CLIP-seq
MIRT1072213	hsa-miR-4692	CLIP-seq
MIRT1072214	hsa-miR-4697-3p	CLIP-seq
MIRT1072215	hsa-miR-4698	CLIP-seq
MIRT1072216	hsa-miR-4700-3p	CLIP-seq
MIRT1072217	hsa-miR-4723-5p	CLIP-seq
MIRT1072218	hsa-miR-4724-3p	CLIP-seq
MIRT1072219	hsa-miR-4733-5p	CLIP-seq
MIRT1072220	hsa-miR-4742-5p	CLIP-seq
MIRT1072221	hsa-miR-4744	CLIP-seq
MIRT1072222	hsa-miR-4758-5p	CLIP-seq
MIRT1072223	hsa-miR-4759	CLIP-seq
MIRT1072224	hsa-miR-4769-5p	CLIP-seq
MIRT1072225	hsa-miR-4795-3p	CLIP-seq
MIRT1072226	hsa-miR-4799-5p	CLIP-seq
MIRT1072227	hsa-miR-4800-3p	CLIP-seq
MIRT1072228	hsa-miR-487b	CLIP-seq
MIRT1072229	hsa-miR-497	CLIP-seq
MIRT1072230	hsa-miR-511	CLIP-seq
MIRT1072231	hsa-miR-513a-3p	CLIP-seq
MIRT1072232	hsa-miR-520d-5p	CLIP-seq
MIRT1072233	hsa-miR-520g	CLIP-seq
MIRT1072234	hsa-miR-520h	CLIP-seq
MIRT1072235	hsa-miR-524-5p	CLIP-seq
MIRT1072236	hsa-miR-539	CLIP-seq
MIRT1072237	hsa-miR-548ag	CLIP-seq
MIRT1072238	hsa-miR-548ai	CLIP-seq
MIRT1072239	hsa-miR-548an	CLIP-seq
MIRT1072240	hsa-miR-554	CLIP-seq
MIRT1072241	hsa-miR-561	CLIP-seq
MIRT1072242	hsa-miR-570	CLIP-seq
MIRT1072243	hsa-miR-574-5p	CLIP-seq
MIRT1072244	hsa-miR-575	CLIP-seq
MIRT1072245	hsa-miR-580	CLIP-seq
MIRT1072246	hsa-miR-619	CLIP-seq
MIRT1072247	hsa-miR-637	CLIP-seq
MIRT1072248	hsa-miR-660	CLIP-seq
MIRT1072249	hsa-miR-7	CLIP-seq
MIRT1072250	hsa-miR-766	CLIP-seq
MIRT1072251	hsa-miR-935	CLIP-seq
MIRT1072252	hsa-miR-944	CLIP-seq
MIRT1072253	hsa-miR-98	CLIP-seq
MIRT1072121	hsa-let-7a	CLIP-seq
MIRT1072122	hsa-let-7b	CLIP-seq
MIRT1072123	hsa-let-7c	CLIP-seq
MIRT1072124	hsa-let-7d	CLIP-seq
MIRT1072125	hsa-let-7e	CLIP-seq
MIRT1072126	hsa-let-7f	CLIP-seq
MIRT1072127	hsa-let-7g	CLIP-seq
MIRT1072128	hsa-let-7i	CLIP-seq
MIRT1550210	hsa-miR-1253	CLIP-seq
MIRT1072148	hsa-miR-202	CLIP-seq
MIRT1072149	hsa-miR-2052	CLIP-seq
MIRT1072157	hsa-miR-3117-3p	CLIP-seq
MIRT1072160	hsa-miR-3169	CLIP-seq
MIRT1072167	hsa-miR-3659	CLIP-seq
MIRT1072187	hsa-miR-4318	CLIP-seq
MIRT1072191	hsa-miR-4458	CLIP-seq
MIRT1072197	hsa-miR-4500	CLIP-seq
MIRT1072207	hsa-miR-4658	CLIP-seq
MIRT1072211	hsa-miR-4676-5p	CLIP-seq
MIRT1072222	hsa-miR-4758-5p	CLIP-seq
MIRT1072223	hsa-miR-4759	CLIP-seq
MIRT1072243	hsa-miR-574-5p	CLIP-seq
MIRT1072244	hsa-miR-575	CLIP-seq
MIRT1072253	hsa-miR-98	CLIP-seq
MIRT1072131	hsa-miR-1208	CLIP-seq
MIRT2017816	hsa-miR-1290	CLIP-seq
MIRT1072133	hsa-miR-141	CLIP-seq
MIRT1072138	hsa-miR-181a	CLIP-seq
MIRT1072139	hsa-miR-181b	CLIP-seq
MIRT1072140	hsa-miR-181c	CLIP-seq
MIRT1072141	hsa-miR-181d	CLIP-seq
MIRT1072145	hsa-miR-1914	CLIP-seq
MIRT1072147	hsa-miR-200a	CLIP-seq
MIRT2017817	hsa-miR-214	CLIP-seq
MIRT1072152	hsa-miR-224	CLIP-seq
MIRT2017818	hsa-miR-30a	CLIP-seq
MIRT2017819	hsa-miR-30b	CLIP-seq
MIRT2017820	hsa-miR-30c	CLIP-seq
MIRT2017821	hsa-miR-30d	CLIP-seq
MIRT2017822	hsa-miR-30e	CLIP-seq
MIRT2017823	hsa-miR-3138	CLIP-seq
MIRT1072159	hsa-miR-3143	CLIP-seq
MIRT2017824	hsa-miR-3171	CLIP-seq
MIRT1072161	hsa-miR-3177-5p	CLIP-seq
MIRT1072162	hsa-miR-3190	CLIP-seq
MIRT2017825	hsa-miR-323b-3p	CLIP-seq
MIRT2017826	hsa-miR-331-5p	CLIP-seq
MIRT2017827	hsa-miR-3611	CLIP-seq
MIRT2017828	hsa-miR-3619-5p	CLIP-seq
MIRT1072168	hsa-miR-3667-5p	CLIP-seq
MIRT2017829	hsa-miR-3911	CLIP-seq
MIRT1072177	hsa-miR-409-5p	CLIP-seq
MIRT1072181	hsa-miR-4262	CLIP-seq
MIRT1072182	hsa-miR-4269	CLIP-seq
MIRT1072184	hsa-miR-4272	CLIP-seq
MIRT1072185	hsa-miR-4291	CLIP-seq
MIRT2017830	hsa-miR-4328	CLIP-seq
MIRT1072192	hsa-miR-4459	CLIP-seq
MIRT2017831	hsa-miR-4477a	CLIP-seq
MIRT1072195	hsa-miR-4477b	CLIP-seq
MIRT1072196	hsa-miR-4489	CLIP-seq
MIRT1072200	hsa-miR-4514	CLIP-seq
MIRT2017832	hsa-miR-451b	CLIP-seq
MIRT1072201	hsa-miR-452	CLIP-seq
MIRT1072204	hsa-miR-4648	CLIP-seq
MIRT1072206	hsa-miR-4654	CLIP-seq
MIRT1072210	hsa-miR-4676-3p	CLIP-seq
MIRT2017833	hsa-miR-4679	CLIP-seq
MIRT1072212	hsa-miR-4683	CLIP-seq
MIRT1072213	hsa-miR-4692	CLIP-seq
MIRT1072215	hsa-miR-4698	CLIP-seq
MIRT1072216	hsa-miR-4700-3p	CLIP-seq
MIRT2017834	hsa-miR-4735-5p	CLIP-seq
MIRT1072220	hsa-miR-4742-5p	CLIP-seq
MIRT2017835	hsa-miR-4753-5p	CLIP-seq
MIRT1072224	hsa-miR-4769-5p	CLIP-seq
MIRT2017836	hsa-miR-4775	CLIP-seq
MIRT2017837	hsa-miR-4778-3p	CLIP-seq
MIRT2017838	hsa-miR-4793-3p	CLIP-seq
MIRT2017839	hsa-miR-4800-5p	CLIP-seq
MIRT2017840	hsa-miR-501-3p	CLIP-seq
MIRT2017841	hsa-miR-502-3p	CLIP-seq
MIRT1072231	hsa-miR-513a-3p	CLIP-seq
MIRT1072232	hsa-miR-520d-5p	CLIP-seq
MIRT1072235	hsa-miR-524-5p	CLIP-seq
MIRT2017842	hsa-miR-543	CLIP-seq
MIRT1072237	hsa-miR-548ag	CLIP-seq
MIRT1072238	hsa-miR-548ai	CLIP-seq
MIRT2017843	hsa-miR-548n	CLIP-seq
MIRT1072241	hsa-miR-561	CLIP-seq
MIRT1072242	hsa-miR-570	CLIP-seq
MIRT1072245	hsa-miR-580	CLIP-seq
MIRT2017844	hsa-miR-590-3p	CLIP-seq
MIRT2017845	hsa-miR-646	CLIP-seq
MIRT2017846	hsa-miR-659	CLIP-seq
MIRT1072249	hsa-miR-7	CLIP-seq
MIRT2017847	hsa-miR-761	CLIP-seq
MIRT2017848	hsa-miR-890	CLIP-seq
MIRT2017849	hsa-miR-922	CLIP-seq
MIRT1072144	hsa-miR-1910	CLIP-seq
MIRT2249653	hsa-miR-203	CLIP-seq
MIRT2249654	hsa-miR-2113	CLIP-seq
MIRT1072151	hsa-miR-223	CLIP-seq
MIRT1072161	hsa-miR-3177-5p	CLIP-seq
MIRT1072162	hsa-miR-3190	CLIP-seq
MIRT2017827	hsa-miR-3611	CLIP-seq
MIRT1072167	hsa-miR-3659	CLIP-seq
MIRT1072175	hsa-miR-3973	CLIP-seq
MIRT1072188	hsa-miR-4419a	CLIP-seq
MIRT1072193	hsa-miR-4461	CLIP-seq
MIRT1072194	hsa-miR-4468	CLIP-seq
MIRT2017831	hsa-miR-4477a	CLIP-seq
MIRT1072199	hsa-miR-4510	CLIP-seq
MIRT2017832	hsa-miR-451b	CLIP-seq
MIRT1072203	hsa-miR-455-3p	CLIP-seq
MIRT2249655	hsa-miR-4639-3p	CLIP-seq
MIRT1072207	hsa-miR-4658	CLIP-seq
MIRT1072211	hsa-miR-4676-5p	CLIP-seq
MIRT1072214	hsa-miR-4697-3p	CLIP-seq
MIRT1072216	hsa-miR-4700-3p	CLIP-seq
MIRT1072219	hsa-miR-4733-5p	CLIP-seq
MIRT1072233	hsa-miR-520g	CLIP-seq
MIRT1072234	hsa-miR-520h	CLIP-seq
MIRT1072236	hsa-miR-539	CLIP-seq
MIRT2017842	hsa-miR-543	CLIP-seq
MIRT1072241	hsa-miR-561	CLIP-seq
MIRT1072243	hsa-miR-574-5p	CLIP-seq
MIRT1072244	hsa-miR-575	CLIP-seq
MIRT1072245	hsa-miR-580	CLIP-seq
MIRT1072249	hsa-miR-7	CLIP-seq
MIRT2249656	hsa-miR-758	CLIP-seq
MIRT2389472	hsa-miR-1264	CLIP-seq
MIRT1072135	hsa-miR-15a	CLIP-seq
MIRT1072136	hsa-miR-15b	CLIP-seq
MIRT1072137	hsa-miR-16	CLIP-seq
MIRT1072146	hsa-miR-195	CLIP-seq
MIRT2389473	hsa-miR-3655	CLIP-seq
MIRT1072174	hsa-miR-3925-3p	CLIP-seq
MIRT1072179	hsa-miR-424	CLIP-seq
MIRT1072202	hsa-miR-4530	CLIP-seq
MIRT1072229	hsa-miR-497	CLIP-seq
MIRT1072249	hsa-miR-7	CLIP-seq
MIRT1072250	hsa-miR-766	CLIP-seq
MIRT1072121	hsa-let-7a	CLIP-seq
MIRT1072122	hsa-let-7b	CLIP-seq
MIRT1072123	hsa-let-7c	CLIP-seq
MIRT1072124	hsa-let-7d	CLIP-seq
MIRT1072125	hsa-let-7e	CLIP-seq
MIRT1072126	hsa-let-7f	CLIP-seq
MIRT1072127	hsa-let-7g	CLIP-seq
MIRT1072128	hsa-let-7i	CLIP-seq
MIRT1072131	hsa-miR-1208	CLIP-seq
MIRT2430088	hsa-miR-1273e	CLIP-seq
MIRT1072133	hsa-miR-141	CLIP-seq
MIRT2430089	hsa-miR-192	CLIP-seq
MIRT1072147	hsa-miR-200a	CLIP-seq
MIRT2430090	hsa-miR-200b	CLIP-seq
MIRT2430091	hsa-miR-200c	CLIP-seq
MIRT1072148	hsa-miR-202	CLIP-seq
MIRT1072149	hsa-miR-2052	CLIP-seq
MIRT2430092	hsa-miR-215	CLIP-seq
MIRT2430093	hsa-miR-3064-3p	CLIP-seq
MIRT1072156	hsa-miR-3065-3p	CLIP-seq
MIRT2017818	hsa-miR-30a	CLIP-seq
MIRT2017819	hsa-miR-30b	CLIP-seq
MIRT2017820	hsa-miR-30c	CLIP-seq
MIRT2017821	hsa-miR-30d	CLIP-seq
MIRT2017822	hsa-miR-30e	CLIP-seq
MIRT1072157	hsa-miR-3117-3p	CLIP-seq
MIRT1072159	hsa-miR-3143	CLIP-seq
MIRT1072160	hsa-miR-3169	CLIP-seq
MIRT2430094	hsa-miR-3173-3p	CLIP-seq
MIRT2430095	hsa-miR-320e	CLIP-seq
MIRT2430096	hsa-miR-33a	CLIP-seq
MIRT2430097	hsa-miR-33b	CLIP-seq
MIRT2430098	hsa-miR-3607-3p	CLIP-seq
MIRT2017827	hsa-miR-3611	CLIP-seq
MIRT2430099	hsa-miR-3616-3p	CLIP-seq
MIRT2389473	hsa-miR-3655	CLIP-seq
MIRT1072167	hsa-miR-3659	CLIP-seq
MIRT2430100	hsa-miR-3686	CLIP-seq
MIRT2430101	hsa-miR-3942-3p	CLIP-seq
MIRT2430102	hsa-miR-4267	CLIP-seq
MIRT2430103	hsa-miR-429	CLIP-seq
MIRT1072185	hsa-miR-4291	CLIP-seq
MIRT1072186	hsa-miR-431	CLIP-seq
MIRT1072187	hsa-miR-4318	CLIP-seq
MIRT2430104	hsa-miR-4428	CLIP-seq
MIRT1072191	hsa-miR-4458	CLIP-seq
MIRT1072195	hsa-miR-4477b	CLIP-seq
MIRT1072197	hsa-miR-4500	CLIP-seq
MIRT2430105	hsa-miR-4503	CLIP-seq
MIRT1072198	hsa-miR-4509	CLIP-seq
MIRT2430106	hsa-miR-450b-5p	CLIP-seq
MIRT1072201	hsa-miR-452	CLIP-seq
MIRT2430107	hsa-miR-4528	CLIP-seq
MIRT1072207	hsa-miR-4658	CLIP-seq
MIRT1072208	hsa-miR-4666-3p	CLIP-seq
MIRT1072210	hsa-miR-4676-3p	CLIP-seq
MIRT2430108	hsa-miR-4724-5p	CLIP-seq
MIRT2430109	hsa-miR-4729	CLIP-seq
MIRT1072221	hsa-miR-4744	CLIP-seq
MIRT1072222	hsa-miR-4758-5p	CLIP-seq
MIRT1072223	hsa-miR-4759	CLIP-seq
MIRT2430110	hsa-miR-4761-3p	CLIP-seq
MIRT2430111	hsa-miR-4766-3p	CLIP-seq
MIRT2430112	hsa-miR-4774-5p	CLIP-seq
MIRT2430113	hsa-miR-4778-5p	CLIP-seq
MIRT2430114	hsa-miR-4779	CLIP-seq
MIRT2430115	hsa-miR-4789-5p	CLIP-seq
MIRT1072226	hsa-miR-4799-5p	CLIP-seq
MIRT2430116	hsa-miR-4803	CLIP-seq
MIRT2430117	hsa-miR-507	CLIP-seq
MIRT1072230	hsa-miR-511	CLIP-seq
MIRT2017842	hsa-miR-543	CLIP-seq
MIRT2430118	hsa-miR-548p	CLIP-seq
MIRT2430119	hsa-miR-557	CLIP-seq
MIRT1072241	hsa-miR-561	CLIP-seq
MIRT1072242	hsa-miR-570	CLIP-seq
MIRT1072243	hsa-miR-574-5p	CLIP-seq
MIRT2430120	hsa-miR-603	CLIP-seq
MIRT2017846	hsa-miR-659	CLIP-seq
MIRT1072249	hsa-miR-7	CLIP-seq
MIRT1072253	hsa-miR-98	CLIP-seq
MIRT2437913	hsa-miR-1305	CLIP-seq
MIRT2017825	hsa-miR-323b-3p	CLIP-seq
MIRT2437914	hsa-miR-582-5p	CLIP-seq
MIRT2437915	hsa-miR-607	CLIP-seq
MIRT2017816	hsa-miR-1290	CLIP-seq
MIRT2430089	hsa-miR-192	CLIP-seq
MIRT2430090	hsa-miR-200b	CLIP-seq
MIRT2430091	hsa-miR-200c	CLIP-seq
MIRT2430092	hsa-miR-215	CLIP-seq
MIRT2553103	hsa-miR-2278	CLIP-seq
MIRT2430093	hsa-miR-3064-3p	CLIP-seq
MIRT2553104	hsa-miR-3121-3p	CLIP-seq
MIRT1072158	hsa-miR-3127-5p	CLIP-seq
MIRT1072159	hsa-miR-3143	CLIP-seq
MIRT2017824	hsa-miR-3171	CLIP-seq
MIRT2553105	hsa-miR-3200-5p	CLIP-seq
MIRT2389473	hsa-miR-3655	CLIP-seq
MIRT1072173	hsa-miR-3910	CLIP-seq
MIRT2430101	hsa-miR-3942-3p	CLIP-seq
MIRT1072177	hsa-miR-409-5p	CLIP-seq
MIRT2430102	hsa-miR-4267	CLIP-seq
MIRT1072183	hsa-miR-4270	CLIP-seq
MIRT2430103	hsa-miR-429	CLIP-seq
MIRT2553106	hsa-miR-4303	CLIP-seq
MIRT2553107	hsa-miR-4433	CLIP-seq
MIRT1072190	hsa-miR-4441	CLIP-seq
MIRT1072192	hsa-miR-4459	CLIP-seq
MIRT1072194	hsa-miR-4468	CLIP-seq
MIRT2430107	hsa-miR-4528	CLIP-seq
MIRT2017833	hsa-miR-4679	CLIP-seq
MIRT2430108	hsa-miR-4724-5p	CLIP-seq
MIRT2553108	hsa-miR-4768-3p	CLIP-seq
MIRT2430112	hsa-miR-4774-5p	CLIP-seq
MIRT2430116	hsa-miR-4803	CLIP-seq
MIRT2017840	hsa-miR-501-3p	CLIP-seq
MIRT2017841	hsa-miR-502-3p	CLIP-seq
MIRT2017842	hsa-miR-543	CLIP-seq
MIRT2553109	hsa-miR-548a-5p	CLIP-seq
MIRT2553110	hsa-miR-548aa	CLIP-seq
MIRT2553111	hsa-miR-548ab	CLIP-seq
MIRT2553112	hsa-miR-548ak	CLIP-seq
MIRT1072239	hsa-miR-548an	CLIP-seq
MIRT2553113	hsa-miR-548b-5p	CLIP-seq
MIRT2553114	hsa-miR-548c-3p	CLIP-seq
MIRT2553115	hsa-miR-548c-5p	CLIP-seq
MIRT2553116	hsa-miR-548d-5p	CLIP-seq
MIRT2553117	hsa-miR-548h	CLIP-seq
MIRT2553118	hsa-miR-548i	CLIP-seq
MIRT2553119	hsa-miR-548j	CLIP-seq
MIRT2017843	hsa-miR-548n	CLIP-seq
MIRT2553120	hsa-miR-548w	CLIP-seq
MIRT2553121	hsa-miR-548y	CLIP-seq
MIRT2553122	hsa-miR-559	CLIP-seq
MIRT2553123	hsa-miR-568	CLIP-seq
MIRT1072242	hsa-miR-570	CLIP-seq
MIRT2430120	hsa-miR-603	CLIP-seq
MIRT2017846	hsa-miR-659	CLIP-seq
MIRT2553124	hsa-miR-802	CLIP-seq
MIRT2017816	hsa-miR-1290	CLIP-seq
MIRT2430089	hsa-miR-192	CLIP-seq
MIRT2430090	hsa-miR-200b	CLIP-seq
MIRT2430091	hsa-miR-200c	CLIP-seq
MIRT2430092	hsa-miR-215	CLIP-seq
MIRT2553103	hsa-miR-2278	CLIP-seq
MIRT2430093	hsa-miR-3064-3p	CLIP-seq
MIRT2553104	hsa-miR-3121-3p	CLIP-seq
MIRT1072159	hsa-miR-3143	CLIP-seq
MIRT2017824	hsa-miR-3171	CLIP-seq
MIRT2553105	hsa-miR-3200-5p	CLIP-seq
MIRT2389473	hsa-miR-3655	CLIP-seq
MIRT1072173	hsa-miR-3910	CLIP-seq
MIRT2430101	hsa-miR-3942-3p	CLIP-seq
MIRT1072177	hsa-miR-409-5p	CLIP-seq
MIRT2430102	hsa-miR-4267	CLIP-seq
MIRT2430103	hsa-miR-429	CLIP-seq
MIRT2553106	hsa-miR-4303	CLIP-seq
MIRT2553107	hsa-miR-4433	CLIP-seq
MIRT1072192	hsa-miR-4459	CLIP-seq
MIRT1072194	hsa-miR-4468	CLIP-seq
MIRT2430107	hsa-miR-4528	CLIP-seq
MIRT2017833	hsa-miR-4679	CLIP-seq
MIRT2430108	hsa-miR-4724-5p	CLIP-seq
MIRT2553108	hsa-miR-4768-3p	CLIP-seq
MIRT2430112	hsa-miR-4774-5p	CLIP-seq
MIRT2430116	hsa-miR-4803	CLIP-seq
MIRT2017840	hsa-miR-501-3p	CLIP-seq
MIRT2017841	hsa-miR-502-3p	CLIP-seq
MIRT2017842	hsa-miR-543	CLIP-seq
MIRT2553109	hsa-miR-548a-5p	CLIP-seq
MIRT2553110	hsa-miR-548aa	CLIP-seq
MIRT2553111	hsa-miR-548ab	CLIP-seq
MIRT2553112	hsa-miR-548ak	CLIP-seq
MIRT1072239	hsa-miR-548an	CLIP-seq
MIRT2553113	hsa-miR-548b-5p	CLIP-seq
MIRT2553114	hsa-miR-548c-3p	CLIP-seq
MIRT2553115	hsa-miR-548c-5p	CLIP-seq
MIRT2553116	hsa-miR-548d-5p	CLIP-seq
MIRT2553117	hsa-miR-548h	CLIP-seq
MIRT2553118	hsa-miR-548i	CLIP-seq
MIRT2553119	hsa-miR-548j	CLIP-seq
MIRT2017843	hsa-miR-548n	CLIP-seq
MIRT2553120	hsa-miR-548w	CLIP-seq
MIRT2553121	hsa-miR-548y	CLIP-seq
MIRT2553122	hsa-miR-559	CLIP-seq
MIRT2553123	hsa-miR-568	CLIP-seq
MIRT1072242	hsa-miR-570	CLIP-seq
MIRT2430120	hsa-miR-603	CLIP-seq
MIRT2017846	hsa-miR-659	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DLX5	Activation	21045156
EIF2AK2	Unknown	20685959
FOXO1	Unknown	20685959
NFIC	Activation	19755487
PGR	Unknown	14534541
SP1	Activation	19755487
SP1	Unknown	19875459
SREBF1	Repression	15881188;16091421
ZNF148	Unknown	19875459

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	ISS
GO:0005068	Function	Transmembrane receptor protein tyrosine kinase adaptor activity	IEA
GO:0005158	Function	Insulin receptor binding	IBA
GO:0005158	Function	Insulin receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	15161933, 15778465, 17901049, 21241768, 23617393, 26496610, 28514442, 33961781, 36931259
GO:0005737	Component	Cytoplasm	IDA	28320862
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006006	Process	Glucose metabolic process	TAS	9495343
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7675087
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	17925406
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0009749	Process	Response to glucose	IEA
GO:0009749	Process	Response to glucose	ISS
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0016477	Process	Cell migration	IEA
GO:0019216	Process	Regulation of lipid metabolic process	TAS	16814735
GO:0019901	Function	Protein kinase binding	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	ISS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032024	Process	Positive regulation of insulin secretion	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0035591	Function	Signaling adaptor activity	IDA	15316008
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0046326	Process	Positive regulation of D-glucose import	IMP	16814735
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IDA	17827393
GO:0051050	Process	Positive regulation of transport	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0055088	Process	Lipid homeostasis	TAS	16814735
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071889	Function	14-3-3 protein binding	IEA
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	IEA
GO:1904692	Process	Positive regulation of type B pancreatic cell proliferation	IEA
GO:1990859	Process	Cellular response to endothelin	IEA

Other IDs

• MIM: 600797
• HGNC: 6126
• e!Ensembl: ENSG00000185950

Protein

• UniProt ID: Q9Y4H2
• Protein name: Insulin receptor substrate 2 (IRS-2)
• Protein function: Signaling adapter protein that participates in the signal transduction from two prominent receptor tyrosine kinases, insulin receptor/INSR and insulin-like growth factor I receptor/IGF1R (PubMed:25879670). Plays therefore an important role in de
• PDB: 3FQW, 3FQX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	31 → 144	PH domain	Domain
  PF02174	IRS	194 → 296	PTB domain (IRS-1 type)	Domain

• Sequence:

  MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
  TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
  YFAVAAENEQEQEGWYRALTDLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
  EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
  QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
  RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
  VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
  AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
  PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFY
  GYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTL
  MRATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGA
  ALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAAVPSAGPAGPAPTSAAGRTF
  PASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
  PDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE
  PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPS
  LPSMHEYPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGS
  GTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPR
  PSASPSSSLQPPPPPPAPGELYRLPPASAVATAQGPGAASSLSSDTGDNGDYTEMAFGVA
  ATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVIRADP
  QGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGGGDEP
  PTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE
  EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTY
  ASIDFLSHHLKEATIVKE

• Sequence length: 1338

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRS2-related disorder	Benign; risk factor; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 2 diabetes mellitus	Benign; risk factor	ClinVar ClinVar, GWAS catalog ClinVar, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31393907		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19190347		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23594372		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	17416760		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19221108		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18802016, 21984580, 27172975, 28608285		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28599074, 32512817	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	2308592, 2538739, 7494873		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18802016, 21984580, 27172975, 28608285		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21984580	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	BEFREE	30474117		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31009952	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24132906, 27483248		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	31009952	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19758361, 20888662		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10674396, 11704861, 15308584, 15509777, 17051426, 17361103, 18611262, 18819936, 19261680, 19920186, 21042750, 23562473, 23877285, 24497996, 24832086, 28234626, 28320862, 29685905		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18611262, 18819936, 21258861, 23562473, 23877285, 24811890, 26991655, 30229539, 30457165, 33432018, 35859293	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34104084, 35844799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23112878	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	23562473	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	29669935	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25820822, 26238771		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26018509	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	33888337	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28708046, 30295821		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29891743		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26755644		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15247132, 15688407, 16448675, 25582198		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15247132		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15247132, 17914103, 23594372, 23877285, 24175768, 25557790, 28212577		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23594372, 24175768, 25557790, 28268248, 28369940, 31666286	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26018509		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23216712		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23216712		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23216712	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18506362, 23216712		★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10417963, 11030756, 12765968, 14604996, 14617753, 15467829, 16327801, 17200721, 19251045, 20947509, 21412220, 21771880, 21926467, 22297304, 22476197, 24289561, 24977713, 29867232, 30367392, 30770439		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	39348384	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24401133, 28846666	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10417963, 11030756, 12765968, 14604996, 14617753, 15467829, 16327801, 17200721, 19251045, 20947509, 21412220, 21771880, 21926467, 22297304, 22476197, 23216712, 24289561, 24977713, 29867232, 29891743, 30367392, 30770439		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	14604996, 21771880, 23216712, 30457165, 34801581	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21984580	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20184486, 24401133, 28049237, 32710190, 37234924	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21984580	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24289561	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10078569, 10480623, 11030756, 11256583, 11473060, 12189449, 12213887, 12519871, 12765968, 14617753, 15127203, 15811564, 16652127, 18267303, 19332049, 20184486, 21325749, 22147666, 22848385, 22994406, 24289561, 24401133, 24977713, 25959789, 26999420, 27514532, 28049237, 28462703, 9399964, 9495343, 9833949		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	15123681, 16086274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23617393, 29891743		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28065675		★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	19878940	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24504452		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20184486		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20184486, 35816477	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19878940		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19878940	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	25458098	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	25458098		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29400692		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	20888662, 23147115, 29717275		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31262748		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	19878940	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21213215		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32669109	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21213215		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23535507	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21926467		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	LHGDN	15155816		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19259821	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	20028942, 25808216		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	23579070, 27514532, 30003110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	BEFREE	10949029, 11259670, 17416760, 21747118, 24977713, 27708333, 28380373, 30003110, 30451856		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25354240		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	12205028		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30964050		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31103287	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	10973656, 15380067, 20184486, 23216712, 24401133, 27535281, 27857189, 29717275, 31996098	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21984580	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
insulinoma	Insulinoma	BEFREE	28886131		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28930970		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	28930970	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30250623		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21412220, 29891743		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17496901		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14596677, 17465001, 24656929, 28710407, 29400692		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16127164		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27458792	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14596677, 17465001		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24289561	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10674396, 11704861, 15308584, 15509777, 17051426, 17361103, 18611262, 18819936, 19261680, 21042750, 23562473, 23877285, 24497996, 24832086, 28234626, 28320862, 29685905		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20184486		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29400692, 29699606		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25820822, 26238771		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9766646		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15678496, 22844442, 25879670, 28126338		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19920186, 23651636, 29685905, 30229539, 30250623, 9766646		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15247132, 15688407, 16448675, 25582198		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14534541, 17051426, 17361103		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15509777, 23562473, 24811175		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	28303061	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36631465	Associate	★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25646961, 38181524	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18802016, 19818665, 22147666, 23147115, 25354240, 25646961, 27172975		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	22465474		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22465474		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	28656082		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	26755644		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14655756, 15509777, 17361103, 17416760, 19095950, 19920186, 21213215, 23562473, 25582198, 26416732, 30250623, 30387841, 31736412		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19259821, 21354306	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30459283		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18360697, 21839075, 29400692, 29699606, 29717275, 29749571		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24289561, 28123847, 30912183, 31393907, 31736412		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29717275		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23562473		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12475767, 12687350, 12765968, 15467829, 16652127, 17925332, 19223519, 19818665, 20184486, 21293001, 21771880, 23018177, 24401133, 30553769, 9399964		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18611262, 20184486, 21771880, 23193206, 24401133, 25310961, 32710190, 33761612, 35124585, 35816477	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	12687350, 19818665		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34856957	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	12379806		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	18079194		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31773671		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31773671	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22246450	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34609082, 35163645, 36727938	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	9766646		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14604996, 19190347		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14604996, 19190347, 20416304	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	34155619	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30387841		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34967697	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11440917, 11522686, 12213887, 15613682, 16037106, 20210696, 21300347, 21801267, 22205343, 22523112, 25310961, 27098445, 28990055		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12213887		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21300347, 24390626, 25310961, 35124585	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15678496, 22844442, 25879670, 28126338, 30338032		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19095950		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22844442, 23251408	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	31996098	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26018509		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	18819936, 20947509		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	23578105	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	19878940	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17496901		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28369940		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	34449768	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24810113, 31393907		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23147115, 29400692, 29717275		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34104084	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30240435		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25921176, 36140796	Associate	★☆☆☆☆ Found in Text Mining only