Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	3654
Gene name	Interleukin 1 receptor associated kinase 1
Gene symbol	IRAK1
Synonyms (NCBI Gene)	IRAKpelle
Chromosome	X
Chromosome location	Xq28
Summary	This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation

349

Show/Hide all (349)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000712	hsa-miR-146a-5p	Western blotNorthern blot	18504431
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	20061417
MIRT000712	hsa-miR-146a-5p	qRT-PCR	18759964
MIRT000712	hsa-miR-146a-5p	qRT-PCRWestern blotImmunofluorescence	19918258
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	ELISALuciferase reporter assayNorthern blotqRT-PCRWestern blot	20542134
MIRT000712	hsa-miR-146a-5p	ELISALuciferase reporter assayNorthern blotqRT-PCRWestern blot	20542134
MIRT000712	hsa-miR-146a-5p	qRT-PCRWestern blot	21178010
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	22593544
MIRT000712	hsa-miR-146a-5p	Western blot	20110513
MIRT024479	hsa-miR-215-5p	Microarray	19074876
MIRT026216	hsa-miR-192-5p	Microarray	19074876
MIRT051021	hsa-miR-17-5p	CLASH	23622248
MIRT049357	hsa-miR-92a-3p	CLASH	23622248
MIRT046662	hsa-miR-222-3p	CLASH	23622248
MIRT045847	hsa-miR-132-3p	CLASH	23622248
MIRT043810	hsa-miR-328-3p	CLASH	23622248
MIRT042485	hsa-miR-423-3p	CLASH	23622248
MIRT041223	hsa-miR-193b-3p	CLASH	23622248
MIRT038891	hsa-miR-93-3p	CLASH	23622248
MIRT038255	hsa-miR-330-5p	CLASH	23622248
MIRT037612	hsa-miR-744-5p	CLASH	23622248
MIRT036505	hsa-miR-1226-3p	CLASH	23622248
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayqRT-PCRWestern blot	23680172
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	23680172
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22992343
MIRT000712	hsa-miR-146a-5p	qRT-PCRWestern blot	23018031
MIRT054357	hsa-miR-21-5p	ChipELISAFlow cytometryLuciferase reporter assayQRTPCRWestern blot	23633945
MIRT000712	hsa-miR-146a-5p	QRTPCRWestern blot	24867582
MIRT000712	hsa-miR-146a-5p	MicroarrayWestern blot	23952003
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT000712	hsa-miR-146a-5p	MicroarrayWestern blot	23952003
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT440429	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440429	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	25623956
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	26151128
MIRT000712	hsa-miR-146a-5p	ELISAImmunohistochemistryqRT-PCRWestern blot	27636999
MIRT000712	hsa-miR-146a-5p	qRT-PCRWestern blot	25889446
MIRT000712	hsa-miR-146a-5p	ELISAEMSAMicroarrayqRT-PCRWestern blot	27922090
MIRT734683	hsa-miR-146b-3p	Luciferase reporter assay	25771167
MIRT000712	hsa-miR-146a-5p	qRT-PCRWestern blot	25805648
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assayqRT-PCRWestern blot	27533309
MIRT000712	hsa-miR-146a-5p	ChIP-seqELISAqRT-PCR	34203452
MIRT000712	hsa-miR-146a-5p	ImmunofluorescenceqRT-PCR	32210951
MIRT733241	hsa-miR-146a-3p	Immunocytochemistry (ICC)Mass spectrometryqRT-PCRWestern blotting	33968923
MIRT733241	hsa-miR-146a-3p	ELISAqRT-PCR	33430976
MIRT734331	hsa-miR-143-3p	ELISAqRT-PCR	33430976
MIRT734681	hsa-miR-21-3p	MicroarrayELISA	31727077
MIRT733241	hsa-miR-146a-3p	MicroarrayELISA	31727077
MIRT734683	hsa-miR-146b-3p	MicroarrayELISA	31727077
MIRT735163	hsa-miR-192-3p	Luciferase reporter assayWestern blottingqRT-PCRELISA	32668391
MIRT000712	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT733241	hsa-miR-146a-3p	Western blottingqRT-PCRFlow cytometryELISA	32117283
MIRT736424	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	32935891
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)Immunofluorescence	37391426
MIRT000712	hsa-miR-146a-5p	qRT-PCRFlow cytometry	35799283
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35777802
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	36175984
MIRT1070321	hsa-miR-1207-3p	CLIP-seq
MIRT1070322	hsa-miR-1208	CLIP-seq
MIRT1070323	hsa-miR-134	CLIP-seq
MIRT1070324	hsa-miR-140-3p	CLIP-seq
MIRT1070325	hsa-miR-1587	CLIP-seq
MIRT1070326	hsa-miR-1914	CLIP-seq
MIRT1070327	hsa-miR-221	CLIP-seq
MIRT1070328	hsa-miR-222	CLIP-seq
MIRT1070329	hsa-miR-2355-5p	CLIP-seq
MIRT1070330	hsa-miR-3118	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT1070332	hsa-miR-3164	CLIP-seq
MIRT1070333	hsa-miR-34b	CLIP-seq
MIRT1070334	hsa-miR-3607-5p	CLIP-seq
MIRT1070335	hsa-miR-3611	CLIP-seq
MIRT1070336	hsa-miR-3617	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070338	hsa-miR-3649	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070343	hsa-miR-3690	CLIP-seq
MIRT1070344	hsa-miR-378g	CLIP-seq
MIRT1070345	hsa-miR-3977	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070347	hsa-miR-4492	CLIP-seq
MIRT1070348	hsa-miR-4498	CLIP-seq
MIRT1070349	hsa-miR-4530	CLIP-seq
MIRT1070350	hsa-miR-4656	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT1070352	hsa-miR-4675	CLIP-seq
MIRT1070353	hsa-miR-4741	CLIP-seq
MIRT1070354	hsa-miR-4786-3p	CLIP-seq
MIRT1070355	hsa-miR-4798-3p	CLIP-seq
MIRT1070356	hsa-miR-490-3p	CLIP-seq
MIRT1070357	hsa-miR-511	CLIP-seq
MIRT1070358	hsa-miR-548v	CLIP-seq
MIRT1070359	hsa-miR-556-3p	CLIP-seq
MIRT1070360	hsa-miR-558	CLIP-seq
MIRT1070361	hsa-miR-619	CLIP-seq
MIRT1070362	hsa-miR-641	CLIP-seq
MIRT1070363	hsa-miR-646	CLIP-seq
MIRT1070364	hsa-miR-648	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT1070366	hsa-miR-762	CLIP-seq
MIRT1070367	hsa-miR-888	CLIP-seq
MIRT1070368	hsa-miR-106a	CLIP-seq
MIRT1070369	hsa-miR-106b	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT1070322	hsa-miR-1208	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070372	hsa-miR-1229	CLIP-seq
MIRT1070373	hsa-miR-1231	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT1070375	hsa-miR-17	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT1070378	hsa-miR-1976	CLIP-seq
MIRT1070379	hsa-miR-20a	CLIP-seq
MIRT1070380	hsa-miR-20b	CLIP-seq
MIRT1070381	hsa-miR-302a	CLIP-seq
MIRT1070382	hsa-miR-302b	CLIP-seq
MIRT1070383	hsa-miR-302c	CLIP-seq
MIRT1070384	hsa-miR-302d	CLIP-seq
MIRT1070385	hsa-miR-302e	CLIP-seq
MIRT1070386	hsa-miR-3120-5p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT1070390	hsa-miR-3672	CLIP-seq
MIRT1070391	hsa-miR-372	CLIP-seq
MIRT1070392	hsa-miR-373	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT1070394	hsa-miR-4312	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070396	hsa-miR-4438	CLIP-seq
MIRT1070397	hsa-miR-4446-5p	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT1070399	hsa-miR-4685-5p	CLIP-seq
MIRT1070400	hsa-miR-4722-3p	CLIP-seq
MIRT1070401	hsa-miR-4726-3p	CLIP-seq
MIRT1070402	hsa-miR-4731-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT1070406	hsa-miR-5095	CLIP-seq
MIRT1070407	hsa-miR-512-3p	CLIP-seq
MIRT1070408	hsa-miR-519d	CLIP-seq
MIRT1070409	hsa-miR-520a-3p	CLIP-seq
MIRT1070410	hsa-miR-520b	CLIP-seq
MIRT1070411	hsa-miR-520c-3p	CLIP-seq
MIRT1070412	hsa-miR-520d-3p	CLIP-seq
MIRT1070413	hsa-miR-520e	CLIP-seq
MIRT1070414	hsa-miR-520g	CLIP-seq
MIRT1070415	hsa-miR-520h	CLIP-seq
MIRT1070416	hsa-miR-555	CLIP-seq
MIRT1070417	hsa-miR-600	CLIP-seq
MIRT1070418	hsa-miR-93	CLIP-seq
MIRT2017311	hsa-miR-1197	CLIP-seq
MIRT1070334	hsa-miR-3607-5p	CLIP-seq
MIRT1070336	hsa-miR-3617	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT1070362	hsa-miR-641	CLIP-seq
MIRT2017312	hsa-miR-146a	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT2017313	hsa-miR-589	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT1070378	hsa-miR-1976	CLIP-seq
MIRT2249210	hsa-miR-3117-3p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT2249211	hsa-miR-3169	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070394	hsa-miR-4312	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT1070400	hsa-miR-4722-3p	CLIP-seq
MIRT2249214	hsa-miR-4724-5p	CLIP-seq
MIRT2249215	hsa-miR-4740-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT2249216	hsa-miR-4759	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT1070407	hsa-miR-512-3p	CLIP-seq
MIRT1070323	hsa-miR-134	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070330	hsa-miR-3118	CLIP-seq
MIRT1070332	hsa-miR-3164	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT1070397	hsa-miR-4446-5p	CLIP-seq
MIRT1070401	hsa-miR-4726-3p	CLIP-seq
MIRT1070355	hsa-miR-4798-3p	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070364	hsa-miR-648	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070321	hsa-miR-1207-3p	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT2552731	hsa-miR-1254	CLIP-seq
MIRT2552732	hsa-miR-1295	CLIP-seq
MIRT1070324	hsa-miR-140-3p	CLIP-seq
MIRT2552733	hsa-miR-148a	CLIP-seq
MIRT2552734	hsa-miR-148b	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT2552735	hsa-miR-152	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT2552736	hsa-miR-1972	CLIP-seq
MIRT1070329	hsa-miR-2355-5p	CLIP-seq
MIRT2552737	hsa-miR-2467-5p	CLIP-seq
MIRT2552738	hsa-miR-2861	CLIP-seq
MIRT2552739	hsa-miR-3064-3p	CLIP-seq
MIRT2552740	hsa-miR-3116	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT2552741	hsa-miR-3188	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070338	hsa-miR-3649	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT2552742	hsa-miR-3929	CLIP-seq
MIRT2552743	hsa-miR-3975	CLIP-seq
MIRT2552744	hsa-miR-4267	CLIP-seq
MIRT2552745	hsa-miR-4293	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT2552746	hsa-miR-4327	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT2552747	hsa-miR-4419b	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT2552748	hsa-miR-4474-3p	CLIP-seq
MIRT2552749	hsa-miR-4478	CLIP-seq
MIRT1070349	hsa-miR-4530	CLIP-seq
MIRT2552750	hsa-miR-4649-3p	CLIP-seq
MIRT2552751	hsa-miR-4663	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT2552752	hsa-miR-4671-5p	CLIP-seq
MIRT2552753	hsa-miR-4717-5p	CLIP-seq
MIRT2552754	hsa-miR-4755-3p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2552755	hsa-miR-485-5p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT2552756	hsa-miR-515-3p	CLIP-seq
MIRT2552757	hsa-miR-519e	CLIP-seq
MIRT2552758	hsa-miR-544b	CLIP-seq
MIRT2552759	hsa-miR-550a	CLIP-seq
MIRT2552760	hsa-miR-566	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070363	hsa-miR-646	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2552761	hsa-miR-663b	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT2552731	hsa-miR-1254	CLIP-seq
MIRT2552733	hsa-miR-148a	CLIP-seq
MIRT2552734	hsa-miR-148b	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT2552735	hsa-miR-152	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT2552737	hsa-miR-2467-5p	CLIP-seq
MIRT2552738	hsa-miR-2861	CLIP-seq
MIRT2552739	hsa-miR-3064-3p	CLIP-seq
MIRT2552740	hsa-miR-3116	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT2552741	hsa-miR-3188	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT2552742	hsa-miR-3929	CLIP-seq
MIRT2552743	hsa-miR-3975	CLIP-seq
MIRT2552745	hsa-miR-4293	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT2552746	hsa-miR-4327	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT2552747	hsa-miR-4419b	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT2552748	hsa-miR-4474-3p	CLIP-seq
MIRT2552749	hsa-miR-4478	CLIP-seq
MIRT2552750	hsa-miR-4649-3p	CLIP-seq
MIRT2552751	hsa-miR-4663	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT2552752	hsa-miR-4671-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2552755	hsa-miR-485-5p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT2552756	hsa-miR-515-3p	CLIP-seq
MIRT2552757	hsa-miR-519e	CLIP-seq
MIRT2552758	hsa-miR-544b	CLIP-seq
MIRT2552759	hsa-miR-550a	CLIP-seq
MIRT2552760	hsa-miR-566	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2552761	hsa-miR-663b	CLIP-seq

Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	IMP	10383454
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002376	Process	Immune system process	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS	10383454
GO:0004672	Function	Protein kinase activity	IDA	12054681
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	11960013
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	11397809
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	11397809
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10854325, 11397809, 11518704, 12242293, 12496252, 12860405, 12874243, 12925853, 16203735, 16831874, 16884718, 17567694, 19081057, 19264966, 21743479, 21903422, 22037600, 26752465, 28436939, 29883609, 33673546, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC
GO:0005737	Component	Cytoplasm	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	25515214
GO:0007254	Process	JNK cascade	IEA
GO:0008063	Process	Toll signaling pathway	IBA
GO:0009986	Component	Cell surface	IDA	22851693
GO:0010008	Component	Endosome membrane	TAS
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IDA	12054681
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019901	Function	Protein kinase binding	IPI	33238146
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IMP	10383454
GO:0032481	Process	Positive regulation of type I interferon production	IMP	23633945
GO:0032496	Process	Response to lipopolysaccharide	IMP	10383454
GO:0032991	Component	Protein-containing complex	IDA	10854325
GO:0032991	Component	Protein-containing complex	IEA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IBA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IEA
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IMP	10383454
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0034605	Process	Cellular response to heat	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0042802	Function	Identical protein binding	IPI	11397809
GO:0042803	Function	Protein homodimerization activity	IPI	10383454
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	22158417
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	TAS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	10383454
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	11397809
GO:0046777	Process	Protein autophosphorylation	IDA	12054681
GO:0046777	Process	Protein autophosphorylation	IDA	11397809
GO:0046982	Function	Protein heterodimerization activity	IPI	10383454
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	16831874
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23633945
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IBA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	11397809
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	10383454
GO:0070555	Process	Response to interleukin-1	IMP	10383454
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214

MIM	HGNC	e!Ensembl
300283	6112	ENSG00000184216

P51617

Protein name

Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1)

Protein function

Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling

PDB

6BFN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	27 → 103	Death domain	Domain
PF00069	Pkinase	212 → 517	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2. {ECO:0000269|PubMed:11397809}.

Sequence

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Sequence length

712

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BYZANTHINE ARCH PALATE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRAK1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS OF CHILDHOOD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URANOSTAPHYLOSCHISIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (196)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30401751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20937840, 23300433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	20500689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anoxia-Ischemia, Brain	Anorexia	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anoxia-Ischemia, Cerebral	Anorexia	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anoxic-Ischemic Encephalopathy	Anoxic-Ischemic Encephalopathy	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	22288586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16169330, 17382928, 18691762, 27270491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30060033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	19166933	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20500689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18759964, 23233309, 28271077, 29734142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20500689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19968634, 30928973, 31435003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16169330, 17382928, 18691762, 27270491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17382928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	28302064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24709033, 24719227, 26142671, 31077459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25550857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28780618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	12619925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26503059, 28967919, 30675215, 30988621, 31111958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22058078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24302991, 37031183, 40028213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36421353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	15548371, 33380238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36138026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20028769	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23383610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	26843707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	26843707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18566305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chorea	Chorea	Pubtator	28302064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	31515286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	28470929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome Xq28 Duplication Syndrome	Chromosome xq28 duplication syndrome	Pubtator	28302064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19288030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	31434702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26498252, 28536249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37256770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30654310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26462859	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34576039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	20524934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20524934, 23794009, 28115805		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	20524934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	26462859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26462859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31077718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25386046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28783585, 30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28783585, 30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33572095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962, 36552771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30260972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19288030, 21249428, 31222667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	28824448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30361091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30401751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	37256770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28980703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	28302064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35193602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	30701447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	24709033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37031183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	36091017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26527316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26527316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30224945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22692818	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	37102608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	31434702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34906138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28572512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18691762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia-Ischemia, Brain	Ischemic Encephalopathy	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	CTD_human_DG	21925238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	28609207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25386046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	28302064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28811005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	24719227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	25341731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28731142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29743719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37172199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31484791, 37172199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29743719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25294684, 27619757, 28356759, 29483095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lubs X-linked mental retardation syndrome	Syndromic Mental Retardation, X-linked	GENOMICS_ENGLAND_DG	28302064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lubs X-linked mental retardation syndrome	Syndromic Mental Retardation, X-linked	BEFREE	29341460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20028769, 25550857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	23428850, 28295231, 29611775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18050247, 21898345, 22904263, 26606652, 31707854, 34931135, 38230454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	23428850, 28295231, 29611775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18050247, 21898345, 22033216, 22904263, 23428850, 23435933, 28295231, 28431280, 29611775, 30149133, 31781262		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18050247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	18050247, 19440199, 22654485, 22904263, 23435933, 23943494		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26606652		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	24386384, 29630120, 30060033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	24386384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	23428850, 28295231, 29611775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25550857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25341731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24357726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26527316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25362351, 26503059, 28967919, 30675215, 30988621, 31111958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23383610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16537705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21632853, 29797599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26503059, 27619757, 28980703, 29483095, 31799178		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15563845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26943583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	31515286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27454822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27454822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30060033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	32210951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23845443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37102608, 37172199, 40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29235894, 29616317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	29784900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24302991, 28356759, 28980703, 29025272, 29483095, 30664786, 30701447, 30988621, 31799178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20716963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25559563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36552771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	12619925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23383610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23383610	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20124483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18474871, 27533309, 29048684, 31662568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	28470929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	26068967, 29184402, 29443320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29235894, 29616317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16537705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	20500689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23018031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	21898345, 23444193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23444193, 28434122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	20716963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18759964, 20870441, 22451023, 23233309, 28207326, 29734142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	23143596		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	27402699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	25341731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	23444193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21898345, 23444193, 25569146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	24701036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16528020, 21537341, 21933552, 22901274, 31306349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	BEFREE	28302064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	26937033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36768371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	19166933	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	28207326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23018031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25550857	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	32572893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26527316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31061316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21632853, 29797599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15523691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	18566305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	21898345, 23444193, 28434122, 28470929, 30308218		★★★★★ ★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	26937033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29048684, 31662568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24526373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	25458699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26503059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26462859, 29632421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	23836557, 25341731, 30126942, 30401751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	23836557, 25341731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IRAK1 (interleukin 1 receptor associated kinase 1)