Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	654502
Gene name	IQ motif containing J
Gene symbol	IQCJ
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q25.32

32 Show/Hide all (32)

miRTarBase ID	miRNA	Experiments
MIRT1069671	hsa-miR-124	CLIP-seq
MIRT1069672	hsa-miR-1254	CLIP-seq
MIRT1069673	hsa-miR-130a	CLIP-seq
MIRT1069674	hsa-miR-130b	CLIP-seq
MIRT1069675	hsa-miR-142-3p	CLIP-seq
MIRT1069676	hsa-miR-301a	CLIP-seq
MIRT1069677	hsa-miR-301b	CLIP-seq
MIRT1069678	hsa-miR-3116	CLIP-seq
MIRT1069679	hsa-miR-3132	CLIP-seq
MIRT1069680	hsa-miR-361-5p	CLIP-seq
MIRT1069681	hsa-miR-3666	CLIP-seq
MIRT1069682	hsa-miR-3714	CLIP-seq
MIRT1069683	hsa-miR-3910	CLIP-seq
MIRT1069684	hsa-miR-3935	CLIP-seq
MIRT1069685	hsa-miR-4295	CLIP-seq
MIRT1069686	hsa-miR-4477b	CLIP-seq
MIRT1069687	hsa-miR-454	CLIP-seq
MIRT1069688	hsa-miR-4671-3p	CLIP-seq
MIRT1069689	hsa-miR-506	CLIP-seq
MIRT1069690	hsa-miR-661	CLIP-seq
MIRT1069691	hsa-miR-873	CLIP-seq
MIRT1069692	hsa-miR-1229	CLIP-seq
MIRT1069693	hsa-miR-1343	CLIP-seq
MIRT1069694	hsa-miR-146a	CLIP-seq
MIRT1069695	hsa-miR-146b-5p	CLIP-seq
MIRT1069679	hsa-miR-3132	CLIP-seq
MIRT1069696	hsa-miR-4789-3p	CLIP-seq
MIRT1069697	hsa-miR-589	CLIP-seq
MIRT2017155	hsa-miR-4420	CLIP-seq
MIRT2017156	hsa-miR-4684-5p	CLIP-seq
MIRT2017157	hsa-miR-4768-5p	CLIP-seq
MIRT2017158	hsa-miR-579	CLIP-seq

MIM	HGNC	e!Ensembl
611622	32406	ENSG00000214216

Q1A5X6

Protein name

IQ domain-containing protein J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15157	IQCJ-SCHIP1	4 → 158	Fusion protein IQCJ-SCHIP1 with IQ-like motif	Family

Sequence

MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREY
LQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDK
LPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ

Sequence length

159

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (9)
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF ADRENAL GLAND	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	28468790	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	28468790	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	37094658	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	33958783	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	26545240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	35893037	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Neuroblastoma	Neuroblastoma	BEFREE	7964753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38484114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29153599		★★★★★ ★☆☆☆☆ Found in Text Mining only

IQCJ (IQ motif containing J)

Bookmark This Gene