Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9670
Gene name	Importin 13
Gene symbol	IPO13
Synonyms (NCBI Gene)	IMP13KAP13LGL2RANBP13
Chromosome	1
Chromosome location	1p34.1
Summary	This gene encodes a member of the importin-beta family of nuclear transport proteins. The encoded protein mediates the import of specific cargo proteins from the cytoplasm to the nucleus and is dependent on the Ras-related nuclear protein-GTPase system. T

12 Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050040	hsa-miR-26b-5p	CLASH	23622248
MIRT040004	hsa-miR-615-3p	CLASH	23622248
MIRT039497	hsa-miR-652-3p	CLASH	23622248
MIRT440439	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT440437	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT440439	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT440437	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT1068734	hsa-miR-2277-3p	CLIP-seq
MIRT1068735	hsa-miR-323-5p	CLIP-seq
MIRT1068736	hsa-miR-542-3p	CLIP-seq
MIRT1068737	hsa-miR-876-3p	CLIP-seq
MIRT1068738	hsa-miR-922	CLIP-seq

Transcription factor	Regulation	Reference
CTCF	Unknown	23620300

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21139563, 23435562, 24722188, 25416956, 26816005, 29892012, 31515488, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006606	Process	Protein import into nucleus	IDA	15964792
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0031267	Function	Small GTPase binding	IEA

MIM	HGNC	e!Ensembl
610411	16853	ENSG00000117408

O94829

Protein name

Importin-13 (Imp13) (Karyopherin-13) (Kap13) (Ran-binding protein 13) (RanBP13)

Protein function

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) t

PDB

2X19 , 2XWU , 3ZJY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03810	IBN_N	45 → 111	Importin-beta N-terminal domain	Family
PF08389	Xpo1	116 → 263	Exportin 1-like protein	Family
PF18773	Importin_rep	402 → 441	Importin 13 repeat	Repeat
PF18786	Importin_rep_2	584 → 627	Importin 13 repeat	Repeat
PF18786	Importin_rep_2	631 → 672	Importin 13 repeat	Repeat
PF18806	Importin_rep_3	826 → 900	Importin 13 repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal brain, heart, intestine and kidney. {ECO:0000269|PubMed:10745026}.

Sequence

MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWH
FSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVL
TRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTS
RLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCE
ALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNG
DMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLT
LTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQF
RIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETI
DVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGN
PELSVSSVSTLKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSA
LQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDISHHEDDH
EGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDF
APMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLTLFQ
QGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKAVFQCAVLALKFPEAPTVKASCGF
FTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLL
SMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYT
ADY

Sequence length

963

Interactions

View interactions

KEGG Pathway
Nucleocytoplasmic transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IPO13-related disorder	Likely benign; Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (18)
Asthma	Asthma	Pubtator	19619331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19619331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23295978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	23295978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29700284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19619331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	29700284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22648251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22648251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22648251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22648251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18199550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24337435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21874049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	29700284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	23559854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24337435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	21804459	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with IPO13 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for IPO13.

Diseases Linked via Similar Genes Diseases curated for genes most similar to IPO13 (see Related Genes above), that are NOT already directly curated for IPO13 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to IPO13.

IPO13 (importin 13)

Bookmark This Gene